Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G10940 147 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G62500 127 / 7e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22142 122 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G15160 108 / 1e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22120 111 / 2e-29 CWLP cell wall-plasma membrane linker protein (.1) AT4G12520 88 / 2e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 88 / 2e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 86 / 2e-21 AZI1 azelaic acid induced 1 (.1) AT2G45180 84 / 9e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 82 / 1e-19 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G126000 [exp] 175 / 8e-54 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G111300 [exp] 125 / 8e-36 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 121 / 8e-35 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 119 / 2e-33 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G015500 [exp] 115 / 3e-30 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 92 / 5e-24 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 86 / 1e-21 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 84 / 9e-21 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 83 / 1e-20 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027704 [exp] 139 / 7e-42 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032262 [exp] 138 / 3e-40 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10028930 [exp] 130 / 9e-38 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004349 [exp] 121 / 2e-34 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010482 [exp] 110 / 1e-31 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10003801 [exp] 112 / 4e-30 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010479 [exp] 99 / 3e-25 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001493 [exp] 95 / 4e-25 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 89 / 1e-22 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10002927 [exp] 88 / 2e-22 AT1G62510 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14547 [poplar] [flax] Hydrophob_seed Hydrophobic seed protein
Representative CDS sequence Show only first row Show all	>Potri.006G065500.2 pacid=42767853 polypeptide=Potri.006G065500.2.p locus=Potri.006G065500 ID=Potri.006G065500.2.v4.1 annot-version=v4.1 ATGGATTCTACCAAAATTTCAGCTTTCCTCTTCCTTTGCATGATCTTCATTTCCTCAGCCGCCCCAACTCTTGACTGTGGTTCTTGTGGCAAGCATCCAA AGAACAAACACCCTAAGACTCCTAAAGCTCCTATTACACTCCCTCCACTTCCAGTTCCTCCAATTGTGAAGCCACCAGTGACTCTGCCTCCACTTCCAGT TCCTCCAATTGTGAAGCCACCAGTTACACTCCCTCCTGTGACACTCCCTCCTGTGACAGTCCCTCCTATCACAGTTCCTCCGGTGACTACAAAGCCACCA AAGGGAAAGCCATGCCCTCCACCTCCATCACCCAAGGATACATGCCCTATTGATACACTAAAACTTGGTGCCTGTGTGGATCTTCTTGGTGGGCTAGTGC ACATTGGCCTTGGTGATCCAGTTGTGAACCAGTGCTGCCCAGTTCTTACAGGACTTGTTGAACTTGAAGCTGCAGTCTGCTTGTGCACCACTCTCAAAAT CAAGGCTCTTAACCTCAATATCTATGTCCCGCTTGCTCTTCAACTCCTTGTTACTTGTGGGAAGACACCTCCTCCTGGTTACACTTGCTCTCTCTAG
AA sequence Show only first row Show all	>Potri.006G065500.2 pacid=42767853 polypeptide=Potri.006G065500.2.p locus=Potri.006G065500 ID=Potri.006G065500.2.v4.1 annot-version=v4.1 MDSTKISAFLFLCMIFISSAAPTLDCGSCGKHPKNKHPKTPKAPITLPPLPVPPIVKPPVTLPPLPVPPIVKPPVTLPPVTLPPVTVPPITVPPVTTKPP KGKPCPPPPSPKDTCPIDTLKLGACVDLLGGLVHIGLGDPVVNQCCPVLTGLVELEAAVCLCTTLKIKALNLNIYVPLALQLLVTCGKTPPPGYTCSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G10940			Bifunctional inhibitor/lipid-t...		Potri.006G065500 [exp]	0	1
AT1G12570			Glucose-methanol-choline (GMC)...		Potri.001G111500 [exp]	1.00	0.9977
AT4G38840			SAUR-like auxin-responsive pro...		Potri.009G126900 [exp]	1.41	0.9975
AT4G08910			unknown protein		Potri.002G231400 [exp]	1.73	0.9975
AT3G05470			Actin-binding FH2 (formin homo...		Potri.005G026300 [exp]	2.23	0.9963
AT2G14900			Gibberellin-regulated family p...		Potri.001G297700 [exp]	4.69	0.9935
AT3G11210			SGNH hydrolase-type esterase s...		Potri.016G115800 [exp]	4.89	0.9958	CPRD49.1
AT5G18080		SAUR24	small auxin up RNA 24, SAUR-li...		Potri.009G127100 [exp]	6.48	0.9956
AT2G18969			unknown protein		Potri.018G090200 [exp]	6.70	0.9950
AT1G55230			Family of unknown function (DU...		Potri.001G009000 [exp]	6.78	0.9879
AT3G55440		CYTOTPI, ATCTIM...	CYTOSOLIC ISOFORM TRIOSE PHOSP...		Potri.001G240300 [exp]	7.34	0.9869

Compare expression of checked genes

Potri.006G065500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.