Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02800 56 / 2e-09 Kin2, APK2B protein kinase 2B (.1.2) AT1G26970 54 / 8e-09 Protein kinase superfamily protein (.1) AT5G02290 54 / 1e-08 NAK Protein kinase superfamily protein (.1.2) AT5G15080 54 / 2e-08 Protein kinase superfamily protein (.1) AT2G28930 53 / 2e-08 APK1B protein kinase 1B (.1.2.3) AT1G07570 52 / 4e-08 APK1A Protein kinase superfamily protein (.1.2.3) AT3G01300 52 / 8e-08 Protein kinase superfamily protein (.1) AT3G28690 51 / 8e-08 Protein kinase superfamily protein (.1.2.3) AT1G76360 51 / 1e-07 Protein kinase superfamily protein (.1) AT1G69790 49 / 4e-07 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G066100 [exp] 80 / 8e-18 AT5G15080 503 / 6e-177 Protein kinase superfamily protein (.1) Potri.018G127300 [exp] 77 / 1e-16 AT3G01300 498 / 5e-175 Protein kinase superfamily protein (.1) Potri.004G129000 [exp] 61 / 4e-11 AT5G15080 659 / 0.0 Protein kinase superfamily protein (.1) Potri.004G123800 [exp] 57 / 1e-09 AT5G15080 694 / 0.0 Protein kinase superfamily protein (.1) Potri.017G077300 [exp] 57 / 1e-09 AT5G15080 690 / 0.0 Protein kinase superfamily protein (.1) Potri.010G093700 [exp] 55 / 5e-09 AT2G02800 627 / 0.0 protein kinase 2B (.1.2) Potri.008G194700 [exp] 55 / 6e-09 AT5G15080 671 / 0.0 Protein kinase superfamily protein (.1) Potri.010G033800 [exp] 54 / 7e-09 AT5G15080 669 / 0.0 Protein kinase superfamily protein (.1) Potri.008G148000 [exp] 54 / 7e-09 AT2G02800 604 / 0.0 protein kinase 2B (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038087 [exp] 73 / 4e-15 AT5G15080 499 / 6e-175 Protein kinase superfamily protein (.1) Lus10006643 [exp] 67 / 3e-13 AT5G15080 495 / 2e-173 Protein kinase superfamily protein (.1) Lus10030668 [exp] 56 / 2e-09 AT5G15080 723 / 0.0 Protein kinase superfamily protein (.1) Lus10005255 [exp] 56 / 2e-09 AT5G15080 720 / 0.0 Protein kinase superfamily protein (.1) Lus10030796 [exp] 55 / 7e-09 AT5G15080 691 / 0.0 Protein kinase superfamily protein (.1) Lus10012850 [exp] 54 / 8e-09 AT2G02800 614 / 0.0 protein kinase 2B (.1.2) Lus10030496 [exp] 54 / 9e-09 AT2G02800 551 / 0.0 protein kinase 2B (.1.2) Lus10003972 [exp] 54 / 2e-08 AT5G02290 448 / 5e-158 Protein kinase superfamily protein (.1.2) Lus10023794 [exp] 53 / 3e-08 AT5G02290 543 / 0.0 Protein kinase superfamily protein (.1.2) Lus10024391 [exp] 53 / 3e-08 AT5G02290 563 / 0.0 Protein kinase superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G066150.2 pacid=42768285 polypeptide=Potri.006G066150.2.p locus=Potri.006G066150 ID=Potri.006G066150.2.v4.1 annot-version=v4.1 ATGCTAAGGAGGCAAAAGAAAGCGATGTTGGTGAGGTTCAATCCGAAGACGGATTTACACGTGAAAGTAATTGTAAAATACGATCTCAGATTGAGCCGCG CCAATATCACTTTCTCAGGGTTATTTGCTTTCCCAGCTTTCACCTCAAGGTCTCTTCTGTCATGTTTTTCTCAATTTCTTTCTTTGGCATGTCTAGTGAT CTTATCCTCCTCACACATTGATGCTACTCTCTTTTGCTACCTTATTTGGTTCACGTTCATACCTGCATTATTACATTTTCCTATAAATACGTACAAACTC TTTGCTCATATACCGTGGCAGATATTGTCCGTCTTTCCCTTGCTCTTCAGCATTCAGCGTTTCCAAGAAGAAGCTGTACCAGGAGCTAGACAAAGTGTCA TATGCACCAACAACAATAAATCTCGATGCCAATTGCTTCAGTTTACCCTTCAAGAACTAAAATCAGCAACTGCGAATTTTAGGCCTGACAGCAATATTCT TAGAGAGGGCGGGCTCGGATACGTGTTTAAAGGATGGATAGGGGAGAATGGGACGTCACTAGCAAATTAA
AA sequence Show only first row Show all	>Potri.006G066150.2 pacid=42768285 polypeptide=Potri.006G066150.2.p locus=Potri.006G066150 ID=Potri.006G066150.2.v4.1 annot-version=v4.1 MLRRQKKAMLVRFNPKTDLHVKVIVKYDLRLSRANITFSGLFAFPAFTSRSLLSCFSQFLSLACLVILSSSHIDATLFCYLIWFTFIPALLHFPINTYKL FAHIPWQILSVFPLLFSIQRFQEEAVPGARQSVICTNNNKSRCQLLQFTLQELKSATANFRPDSNILREGGLGYVFKGWIGENGTSLAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Potri.006G066150 [exp]	0	1
AT1G68730			Zim17-type zinc finger protein...		Potri.010G132400 [exp]	1.00	0.9010
					Potri.019G029850 [exp]	3.00	0.8649
AT2G17570			Undecaprenyl pyrophosphate syn...		Potri.002G039400 [exp]	4.89	0.8942
					Potri.002G034250 [exp]	9.00	0.8147
					Potri.010G019550 [exp]	9.16	0.8337
AT1G02460			Pectin lyase-like superfamily ...		Potri.002G190600 [exp]	9.38	0.8619
					Potri.003G133350 [exp]	10.39	0.7927
AT4G02810		FAF1	FANTASTIC FOUR 1, Protein of u...		Potri.002G053400 [exp]	10.67	0.8736
					Potri.001G282604 [exp]	11.31	0.8670
AT3G20640	bHLH	bHLH123	basic helix-loop-helix (bHLH) ...		Potri.001G410600 [exp]	11.61	0.8549

Compare expression of checked genes

Potri.006G066150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.