Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28640 104 / 5e-27 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT4G32280 100 / 1e-25 AUX_IAA IAA29 indole-3-acetic acid inducible 29 (.1) AT1G04550 92 / 2e-22 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT2G33310 89 / 3e-21 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT1G15580 82 / 2e-19 AUX_IAA ATAUX2-27, IAA5 AUXIN-INDUCIBLE 2-27, indole-3-acetic acid inducible 5 (.1) AT1G04100 84 / 3e-19 AUX_IAA IAA10 indoleacetic acid-induced protein 10 (.1) AT1G51950 82 / 1e-18 AUX_IAA IAA18 indole-3-acetic acid inducible 18 (.1) AT5G25890 80 / 2e-18 AUX_IAA IAR2, IAA28 IAA-ALANINE RESISTANT 2, indole-3-acetic acid inducible 28 (.1) AT5G43700 79 / 6e-18 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT3G16500 80 / 1e-17 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G127800 [exp] 407 / 4e-146 AT1G04550 94 / 2e-23 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) Potri.006G255200 [exp] 178 / 4e-56 AT4G32280 137 / 7e-40 indole-3-acetic acid inducible 29 (.1) Potri.008G161100 [exp] 89 / 1e-21 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G045000 [exp] 88 / 3e-21 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 87 / 9e-21 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.010G065200 [exp] 87 / 2e-20 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.005G218200 [exp] 85 / 3e-20 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.013G041300 [exp] 84 / 8e-20 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.013G041400 [exp] 82 / 7e-19 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039488 [exp] 89 / 1e-21 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10039413 [exp] 89 / 1e-21 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10001501 [exp] 86 / 1e-20 AT1G04100 81 / 9e-19 indoleacetic acid-induced protein 10 (.1) Lus10024853 [exp] 86 / 5e-20 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10014729 [exp] 85 / 8e-20 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10002723 [exp] 84 / 9e-20 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10023719 [exp] 86 / 1e-19 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10014464 [exp] 86 / 2e-19 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10034962 [exp] 85 / 3e-19 AT4G29080 289 / 4e-97 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Lus10022868 [exp] 84 / 5e-19 AT4G28640 198 / 1e-62 indole-3-acetic acid inducible 11 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF02309 [poplar] [flax] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Potri.006G066600.1 pacid=42768760 polypeptide=Potri.006G066600.1.p locus=Potri.006G066600 ID=Potri.006G066600.1.v4.1 annot-version=v4.1 ATGGAACTTCAACTTGGTCTCGGTCTTCCAAGTGAAAAAACAATGAAGGGTTTGGACCTAAACAGCTATGTTTCGGAGCCTAAAGAGTTGCTGGGCTCGG GCCAACTTCACCTGGGTTCATATTCGTGGTTTTCTACAAATGATAATGACAAGAAACGGAGTTTTATTGATGCCTCTGAAGAGAGCTCGAGAAATGAAGA CGTGCCTCGAACGCTGCCTCTCTTGGTTTGGAATAACCAGCCAAACGAGGAAGATGATCCGCCTAAAGATCTTGATAACCACTGCAACTACTCTTTTTCC TCCAACAAAAGTGATGGAGAAAGTGATGGAATAGTGGGGTGGCCACCAATAAAGTTCAAGAGGAAGAAGCTTAGTCGTCAAAACAGTAGAGTGCTAGAGG TTAATCGGGCAGTGGACAATGGTTGTGAAGATTGCCAAGCTAGATCATCAAACTCCATGTACATTAAGGTCAAGATGGAGGGAGTAGGAATAGCAAGGAA AATTGATGTTAGCGTCTACCGTTGCTTTCCAACACTTAAACATACGTTGCTTGACATGTTTGGGATCTGCCAGGAAAATTCAAGCAACTACAGACTGACT TACCAGGATAGAGAAGGTGACTGGCTACTAGCTGAAGATGTACCTTGGAGGAACTTTCTTGGGTCAGTCCAACGACTAAAACTGATGAGGAGCAGCAATT GA
AA sequence Show only first row Show all	>Potri.006G066600.1 pacid=42768760 polypeptide=Potri.006G066600.1.p locus=Potri.006G066600 ID=Potri.006G066600.1.v4.1 annot-version=v4.1 MELQLGLGLPSEKTMKGLDLNSYVSEPKELLGSGQLHLGSYSWFSTNDNDKKRSFIDASEESSRNEDVPRTLPLLVWNNQPNEEDDPPKDLDNHCNYSFS SNKSDGESDGIVGWPPIKFKRKKLSRQNSRVLEVNRAVDNGCEDCQARSSNSMYIKVKMEGVGIARKIDVSVYRCFPTLKHTLLDMFGICQENSSNYRLT YQDREGDWLLAEDVPWRNFLGSVQRLKLMRSSN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G28640	AUX_IAA	IAA11	indole-3-acetic acid inducible...		Potri.006G066600 [exp]	0	1
AT4G35550	HD	HB-4, WOX13, AT...	WUSCHEL related homeobox 13 (....		Potri.002G008800 [exp]	3.60	0.8575	HB1.3
AT3G04810		ATNEK2	NIMA-related kinase 2 (.1.2)		Potri.002G049400 [exp]	4.47	0.8471
AT5G41800			Transmembrane amino acid trans...		Potri.003G138100 [exp]	7.34	0.8404
AT3G15480			Protein of unknown function (D...		Potri.001G403500 [exp]	7.34	0.7987
AT4G28500	NAC	ANAC073, SND2, ...	SECONDARY WALL-ASSOCIATED NAC ...		Potri.011G058400 [exp]	10.00	0.8226
AT4G14746			unknown protein		Potri.008G156800 [exp]	10.48	0.7211
AT3G56190		ASNAP, ALPHA-SN...	alpha-soluble NSF attachment p...		Potri.016G129900 [exp]	10.90	0.7711	ASNAP.2
AT1G22410			Class-II DAHP synthetase famil...		Potri.002G099200 [exp]	12.80	0.8232
AT4G25433			peptidoglycan-binding LysM dom...		Potri.012G135100 [exp]	15.19	0.8060
AT1G16290			unknown protein		Potri.008G084100 [exp]	17.83	0.8074

Compare expression of checked genes

Potri.006G066600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.