Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G24040 155 / 1e-45 TREHALASE1, ATTRE1 trehalase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G144000 [exp] 263 / 2e-86 AT4G24040 706 / 0.0 trehalase 1 (.1) Potri.003G143900 [exp] 246 / 2e-80 AT4G24040 692 / 0.0 trehalase 1 (.1) Potri.001G087100 [exp] 246 / 5e-80 AT4G24040 685 / 0.0 trehalase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023034 [exp] 218 / 4e-69 AT4G24040 683 / 0.0 trehalase 1 (.1) Lus10032435 [exp] 216 / 1e-68 AT4G24040 653 / 0.0 trehalase 1 (.1) Lus10023035 [exp] 212 / 5e-67 AT4G24040 667 / 0.0 trehalase 1 (.1) Lus10032434 [exp] 139 / 3e-40 AT4G24040 540 / 0.0 trehalase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0059 [poplar] [flax] 6_Hairpin PF01204 [poplar] [flax] Trehalase Trehalase
Representative CDS sequence Show only first row Show all	>Potri.006G068300.2 pacid=42770612 polypeptide=Potri.006G068300.2.p locus=Potri.006G068300 ID=Potri.006G068300.2.v4.1 annot-version=v4.1 ATGAGAAGTTTTCAAAGTTCAGGCCTGGTTCATGCTGCTGGAATTGCCACTTCTTTAATAAATTCGGGACAGCAATGGGACTTTCCAAATGGTTGGGCTC CACTTCAACACATGATAGTTGAAGGTTTGCTGAGATCTGGATTAAAAGAAGCAAGGTCATTGGCAGAAGACATAGCTGTGAGGTGGATCAAAACCAACTA CATTGGATACAAGAAAACGGGCGCAATGCATGAAAAATATGATGTGCGAAAGTGTGGAGCATTCGGAGGTGGTGGAGAATACATACCCCAGACTGGTTTT GGTTGGTCAAATGGAGTTGTGTTGACATTTTTGGAGGAGTTTGGATGGCCTGAAGACCGGAGCATAGGTTGCTGA
AA sequence Show only first row Show all	>Potri.006G068300.2 pacid=42770612 polypeptide=Potri.006G068300.2.p locus=Potri.006G068300 ID=Potri.006G068300.2.v4.1 annot-version=v4.1 MRSFQSSGLVHAAGIATSLINSGQQWDFPNGWAPLQHMIVEGLLRSGLKEARSLAEDIAVRWIKTNYIGYKKTGAMHEKYDVRKCGAFGGGGEYIPQTGF GWSNGVVLTFLEEFGWPEDRSIGC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G24040		TREHALASE1, ATT...	trehalase 1 (.1)		Potri.006G068300 [exp]	0	1
AT3G57170			N-acetylglucosaminyl transfera...		Potri.006G044500 [exp]	3.31	0.7319
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Potri.011G040500 [exp]	9.48	0.7153
					Potri.017G069350 [exp]	10.58	0.6383
AT2G12646			PLATZ transcription factor fam...		Potri.018G116000 [exp]	13.41	0.6932
AT2G46570		LAC6	laccase 6 (.1)		Potri.014G100600 [exp]	18.49	0.7015
AT5G28150			Plant protein of unknown funct...		Potri.002G051600 [exp]	22.27	0.7210
AT1G04360			RING/U-box superfamily protein...		Potri.008G165900 [exp]	24.16	0.6986
AT5G51100		FSD2	Fe superoxide dismutase 2 (.1)		Potri.015G110400 [exp]	27.01	0.6976
AT3G12600		ATNUDT16	nudix hydrolase homolog 16 (.1...		Potri.016G036700 [exp]	32.01	0.6663
AT1G75717			unknown protein		Potri.005G238400 [exp]	32.32	0.6791

Compare expression of checked genes

Potri.006G068300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.