Potri.006G071700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004293 43 / 3e-06 ND /
Lus10019223 40 / 0.0001 ND /
PFAM info
Representative CDS sequence
>Potri.006G071700.2 pacid=42767294 polypeptide=Potri.006G071700.2.p locus=Potri.006G071700 ID=Potri.006G071700.2.v4.1 annot-version=v4.1
ATGAAACTTTTGCATCTTCTCTTGTTGGCGATGCTTACAACTGCTTTTTATTTCTTTTCCCAGAACATCTGTTCTACTTCTTCCCCTTCCATGTTTTTCC
TCACAGGAAGGAGATCCATGAGAGAACAGAGATCCATGAGGGAACAGAGGATGTCATCGGTCACCCTCAGAGATGAGCATGAGAATACCAAGGTTCTTGA
TGAAAAGACTGAGCAAGCAACAATCAAGGAAGATTCTAGGCAACTGGCGTATCCAAGCAGCACTGATAATTTAGATGATCTTGTTTACCACGTTGATTAC
CATGGCGTGACAACTCATCCAACTCCAACTCCAAAGCATCCCAAACCCTAA
AA sequence
>Potri.006G071700.2 pacid=42767294 polypeptide=Potri.006G071700.2.p locus=Potri.006G071700 ID=Potri.006G071700.2.v4.1 annot-version=v4.1
MKLLHLLLLAMLTTAFYFFSQNICSTSSPSMFFLTGRRSMREQRSMREQRMSSVTLRDEHENTKVLDEKTEQATIKEDSRQLAYPSSTDNLDDLVYHVDY
HGVTTHPTPTPKHPKP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G071700 0 1
AT1G03010 Phototropic-responsive NPH3 fa... Potri.014G133500 1.41 0.8353
AT2G37300 ABCI16 ATP-binding cassette I16, unkn... Potri.006G216300 3.74 0.8286
AT1G75500 WAT1 Walls Are Thin 1 (.1.2) Potri.002G029100 6.00 0.7997
AT4G38430 ATROPGEF1, ROPG... rho guanyl-nucleotide exchange... Potri.005G247100 13.78 0.7632
AT1G72740 MYB Homeodomain-like/winged-helix ... Potri.018G066300 14.83 0.7563 SMH903
AT3G08490 unknown protein Potri.009G061300 15.36 0.7923
AT5G06470 Glutaredoxin family protein (.... Potri.016G067700 18.16 0.7720
AT5G09800 ARM repeat superfamily protein... Potri.005G057500 18.65 0.7418
AT1G05460 SDE3 SILENCING DEFECTIVE, P-loop co... Potri.008G155400 18.84 0.7023 RHEL901,SDE3.1
AT1G54610 Protein kinase superfamily pro... Potri.002G065100 21.21 0.7656

Potri.006G071700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.