Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46540 131 / 9e-37 ABCB7, PGP7 ATP-binding cassette B7, P-glycoprotein 7 (.1) AT3G62150 119 / 2e-32 ABCB21, PGP21 ATP-binding cassette B21, P-glycoprotein 21 (.1) AT2G47000 117 / 9e-32 PGP4 ,MDR4, ABCB4, ATPGP4 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) AT4G01820 116 / 2e-31 ABCB3, MDR3, PGP3 ATP-binding cassette B3, P-glycoprotein 3 (.1) AT1G02530 115 / 2e-31 ABCB12, PGP12 ATP-binding cassette B12, P-glycoprotein 12 (.1) AT1G02520 115 / 5e-31 MDR8, ABCB11, PGP11 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) AT4G01830 113 / 2e-30 ABCB5, PGP5 ATP-binding cassette B5, P-glycoprotein 5 (.1) AT4G18050 112 / 4e-30 ABCB9, PGP9 ATP-binding cassette B9, P-glycoprotein 9 (.1) AT3G28415 70 / 5e-15 ABCB22 ATP-binding cassette B22, ABC transporter family protein (.1) AT3G28360 68 / 2e-14 ABCB16, PGP16 ATP-binding cassette B16, P-glycoprotein 16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G354900 [exp] 165 / 2e-48 AT4G18050 1723 / 0.0 ATP-binding cassette B9, P-glycoprotein 9 (.1) Potri.014G113500 [exp] 133 / 2e-37 AT3G62150 1879 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113000 [exp] 132 / 3e-37 AT3G62150 1767 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113200 [exp] 130 / 3e-36 AT3G62150 1871 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.002G187500 [exp] 129 / 3e-36 AT3G62150 1860 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.002G187400 [exp] 129 / 8e-36 AT3G62150 1702 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Potri.014G113100 [exp] 128 / 1e-35 AT1G02520 1773 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Potri.010G003000 [exp] 114 / 6e-31 AT2G47000 1585 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Potri.006G074400 [exp] 81 / 7e-19 AT3G28345 1243 / 0.0 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004583 [exp] 147 / 4e-42 AT4G18050 1660 / 0.0 ATP-binding cassette B9, P-glycoprotein 9 (.1) Lus10038049 [exp] 133 / 2e-37 AT3G62150 1891 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10009988 [exp] 132 / 4e-37 AT3G62150 1896 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10010074 [exp] 126 / 6e-35 AT1G02520 1591 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Lus10038050 [exp] 121 / 3e-33 AT2G47000 1697 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10004520 [exp] 121 / 3e-33 AT2G47000 1145 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10009989 [exp] 120 / 1e-32 AT2G47000 1754 / 0.0 MULTIDRUG RESISTANCE 4, ARABIDOPSIS P-GLYCOPROTEIN 4, ATP-binding cassette B4, ATP binding cassette subfamily B4 (.1) Lus10010067 [exp] 120 / 1e-32 AT1G02520 1748 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Lus10010068 [exp] 118 / 4e-32 AT3G62150 1820 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10010012 [exp] 116 / 2e-31 AT1G02520 1526 / 0.0 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0241 [poplar] [flax] ABC_membrane PF00664 [poplar] [flax] ABC_membrane ABC transporter transmembrane region
Representative CDS sequence Show only first row Show all	>Potri.006G071901.1 pacid=42770197 polypeptide=Potri.006G071901.1.p locus=Potri.006G071901 ID=Potri.006G071901.1.v4.1 annot-version=v4.1 ATGGTTACCCCTATTCTTGGCCTTTTACTATCGAAAGCCATTACTATGTACCAAGAACCTCCAGAGGAGATGCGAAAAGATTCCAAGTTCTGGGCAATCG TGTGTGTGGGAATCGGTTTGATTACCTTTGTAGCCCTTTCATTGAGAAGTTACCTTTTTGGGATTGCCGGGGCTAAGTTGATTGAACGAATTCGTTCGAT GACAATATTTGAAAAAGTTGCATGCCAAGAAATTAGCTGGTTTGATGATCTTGCAAATTCGAGTGGTGCGGTTGGTGCAAGGTTATCAACCGATGCTTCA ACAGTTAGGAGTCTTGTTGGAGATCATTGA
AA sequence Show only first row Show all	>Potri.006G071901.1 pacid=42770197 polypeptide=Potri.006G071901.1.p locus=Potri.006G071901 ID=Potri.006G071901.1.v4.1 annot-version=v4.1 MVTPILGLLLSKAITMYQEPPEEMRKDSKFWAIVCVGIGLITFVALSLRSYLFGIAGAKLIERIRSMTIFEKVACQEISWFDDLANSSGAVGARLSTDAS TVRSLVGDH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G46540		ABCB7, PGP7	ATP-binding cassette B7, P-gly...		Potri.006G071901 [exp]	0	1
					Potri.016G068650 [exp]	15.62	0.6755
					Potri.010G112701 [exp]	18.00	0.6727
AT1G13260	AP2_ERF	EDF4, RAV1	ETHYLENE RESPONSE DNA BINDING ...		Potri.015G015650 [exp]	23.04	0.6607
					Potri.006G047250 [exp]	29.73	0.6117
AT1G13260	AP2_ERF	EDF4, RAV1	ETHYLENE RESPONSE DNA BINDING ...		Potri.015G015501 [exp]	31.74	0.6099
AT4G29250			HXXXD-type acyl-transferase fa...		Potri.018G032700 [exp]	56.49	0.5562
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.015G015275 [exp]	56.53	0.6346
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.004G043600 [exp]	68.14	0.5228
AT5G27930			Protein phosphatase 2C family ...		Potri.013G012200 [exp]	87.89	0.5567
AT5G23260	MADS	ABS, TT16, AGL3...	TRANSPARENT TESTA16, AGAMOUS-l...		Potri.007G073000 [exp]	103.63	0.4689

Compare expression of checked genes

Potri.006G071901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.