Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57123 97 / 7e-29 unknown protein AT4G29905 87 / 1e-24 unknown protein AT5G10695 84 / 3e-23 unknown protein AT3G15534 47 / 5e-09 unknown protein AT1G52855 47 / 9e-09 unknown protein AT2G20835 44 / 1e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G140500 [exp] 127 / 7e-41 AT5G57123 99 / 1e-29 unknown protein Potri.018G007300 [exp] 95 / 8e-28 AT5G10695 102 / 6e-31 unknown protein Potri.010G251000 [exp] 62 / 1e-14 AT5G10695 39 / 1e-05 unknown protein Potri.008G007932 [exp] 58 / 3e-13 AT4G29905 54 / 1e-11 unknown protein Potri.008G007800 [exp] 57 / 5e-13 AT4G29905 54 / 1e-11 unknown protein Potri.019G104300 [exp] 47 / 8e-09 AT1G52855 116 / 2e-36 unknown protein Potri.019G104100 [exp] 47 / 8e-09 AT1G52855 116 / 2e-36 unknown protein Potri.001G405400 [exp] 45 / 6e-08 AT1G52855 85 / 9e-24 unknown protein Potri.011G124800 [exp] 44 / 2e-07 AT1G52855 119 / 1e-37 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026229 [exp] 89 / 2e-25 AT5G10695 107 / 1e-32 unknown protein Lus10042440 [exp] 89 / 2e-25 AT5G10695 107 / 1e-32 unknown protein Lus10039793 [exp] 47 / 1e-08 AT2G20835 115 / 7e-36 unknown protein Lus10018561 [exp] 45 / 6e-08 AT2G20835 111 / 2e-34 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G073400.1 pacid=42769514 polypeptide=Potri.006G073400.1.p locus=Potri.006G073400 ID=Potri.006G073400.1.v4.1 annot-version=v4.1 ATGTGTTTTGTGTTCTTATGTGACGAAGAAGAGAAGGAATTAGGCAGGCAACAAGCTTCAGGGTCATGTCCTCACTGTGGAGGTAAAGTACAAGCCGTGG ATTTTGAAGGCCGGTGGCGGTTCTGTTTCTTGCCCATATGCTACAAGATGAAGAGAAAATATTTTTGTACTTTATGTTCCAGGCGGCTGGAATTATCTCC TTAA
AA sequence Show only first row Show all	>Potri.006G073400.1 pacid=42769514 polypeptide=Potri.006G073400.1.p locus=Potri.006G073400 ID=Potri.006G073400.1.v4.1 annot-version=v4.1 MCFVFLCDEEEKELGRQQASGSCPHCGGKVQAVDFEGRWRFCFLPICYKMKRKYFCTLCSRRLELSP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57123			unknown protein		Potri.006G073400 [exp]	0	1
					Potri.017G045000 [exp]	1.00	0.9301
AT1G72430			SAUR-like auxin-responsive pro...		Potri.003G071000 [exp]	4.58	0.8593
AT3G14470			NB-ARC domain-containing disea...		Potri.017G133600 [exp]	5.47	0.8996
AT1G25560	AP2_ERF	EDF1, TEM1	TEMPRANILLO 1, ETHYLENE RESPON...		Potri.010G129200 [exp]	5.65	0.8990	RAV2.2,RAV1
AT4G13830		J20	DNAJ-like 20 (.1.2)		Potri.007G088900 [exp]	10.95	0.8977
AT4G00231		MEE50	maternal effect embryo arrest ...		Potri.008G158901 [exp]	12.36	0.8827
AT4G24570		DIC2	dicarboxylate carrier 2 (.1)		Potri.007G113000 [exp]	14.49	0.8836
AT2G40000		ATHSPRO2	ARABIDOPSIS ORTHOLOG OF SUGAR ...		Potri.008G066000 [exp]	18.65	0.8519
					Potri.015G025600 [exp]	19.41	0.8697
AT1G23710			Protein of unknown function (D...		Potri.010G041300 [exp]	21.23	0.8704

Compare expression of checked genes

Potri.006G073400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.