Potri.006G076300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57230 263 / 1e-91 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G143500 301 / 7e-107 AT5G57230 274 / 7e-96 Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003582 258 / 3e-89 AT5G57230 264 / 6e-92 Thioredoxin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.006G076300.6 pacid=42768138 polypeptide=Potri.006G076300.6.p locus=Potri.006G076300 ID=Potri.006G076300.6.v4.1 annot-version=v4.1
ATGGAGGAGAAATCATTTTTGGATAGAATGCTTGGTCATCTACGCGAAACATGCAAGTACTCTACTGGGTATCCCAAGGATCTTGGGCCATCACGGGTTA
TTCACTTTACGTCAGAGCGTGAGTTTGTCCAGCTTCTTCACCAAGGGTACCCGGTTGTAGTAGCTTTTACCATCAGAGGCAATTACACCAAACACCTTGA
CCAGGTTCTTGAGGTAGCCGCTGCTGAATTTTATCCACATGTAAAATTTTTGCGTGTTGAATGTCCAAAATATCCTGGCTTTTGTATAACTCGGCAGAGG
AAGGAATATCCATTCATTGAAATATTCCATAGCCCAGAACAAGCAGCTAATCGGGGAAGGGTTGGTGGTCCAAATATCACGAAATACTCTGCGAAGGCTC
TTCCTTTCAACTATGACCTGAGTGCCTATGGATTCAGAGAATTTTTCAAGCGTTATGGCATACAATCATCGCAGGAGCCAAAGTAA
AA sequence
>Potri.006G076300.6 pacid=42768138 polypeptide=Potri.006G076300.6.p locus=Potri.006G076300 ID=Potri.006G076300.6.v4.1 annot-version=v4.1
MEEKSFLDRMLGHLRETCKYSTGYPKDLGPSRVIHFTSEREFVQLLHQGYPVVVAFTIRGNYTKHLDQVLEVAAAEFYPHVKFLRVECPKYPGFCITRQR
KEYPFIEIFHSPEQAANRGRVGGPNITKYSAKALPFNYDLSAYGFREFFKRYGIQSSQEPK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G57230 Thioredoxin superfamily protei... Potri.006G076300 0 1
AT2G21060 ATCSP4, ATGRP2B COLD SHOCK DOMAIN PROTEIN 4, g... Potri.004G172600 4.69 0.7906 Pt-GRP2.3
AT1G06475 unknown protein Potri.002G058400 9.32 0.8036
AT1G67320 EMB2813 EMBRYO DEFECTIVE 2813, DNA pri... Potri.003G169300 10.39 0.7532
AT5G59970 Histone superfamily protein (.... Potri.007G013500 13.85 0.7768 HFO909
AT3G13674 unknown protein Potri.018G082800 14.14 0.7725
AT2G25570 binding (.1.2.3) Potri.001G219400 14.89 0.6642
AT4G29910 EMB2798, ORC5, ... EMBRYO DEFECTIVE 2798, origin ... Potri.014G085900 15.96 0.7533
AT3G57290 ATINT6, ATEIF3E... eukaryotic translation initiat... Potri.016G043800 16.73 0.7240 EIF3.3
AT3G05870 APC11 anaphase-promoting complex/cyc... Potri.017G037701 26.22 0.7466
AT3G19660 unknown protein Potri.004G105900 26.83 0.7344

Potri.006G076300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.