Potri.006G076350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.006G076350.1 pacid=42770260 polypeptide=Potri.006G076350.1.p locus=Potri.006G076350 ID=Potri.006G076350.1.v4.1 annot-version=v4.1
ATGTCCATTACTATTATAGCACGTTTCCAGCATCTTTTGAAGGTGTTAAGAGTCTATGCTGCAGCATGGAAACTAAGGGGTATGAAGACATCGAGGAAGT
TTACTATTGAGATGGAACAAAGTCGGGAAGCAATACCTTGCAATGCTGCATGA
AA sequence
>Potri.006G076350.1 pacid=42770260 polypeptide=Potri.006G076350.1.p locus=Potri.006G076350 ID=Potri.006G076350.1.v4.1 annot-version=v4.1
MSITIIARFQHLLKVLRVYAAAWKLRGMKTSRKFTIEMEQSREAIPCNAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G076350 0 1
AT4G10490 2-oxoglutarate (2OG) and Fe(II... Potri.014G106700 1.73 1.0000
AT4G37280 MRG family protein (.1) Potri.002G122500 3.46 1.0000
AT1G47670 Transmembrane amino acid trans... Potri.004G181000 4.89 0.9937
Potri.010G120401 6.70 0.9729
AT3G44540 FAR4 fatty acid reductase 4 (.1.2) Potri.009G145100 7.41 0.9482
Potri.003G010664 10.39 0.9269
AT2G33670 ATMLO5, MLO5 MILDEW RESISTANCE LOCUS O 5, S... Potri.002G006700 12.04 0.8515
AT4G16160 ATOEP16-2, ATOE... Mitochondrial import inner mem... Potri.010G142300 17.94 0.7853
AT1G58170 Disease resistance-responsive ... Potri.016G061000 23.04 0.7424
AT5G43580 UPI UNUSUAL SERINE PROTEASE INHIBI... Potri.005G221000 24.00 0.8661

Potri.006G076350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.