Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL12.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37190 295 / 7e-104 Ribosomal protein L11 family protein (.1) AT5G60670 295 / 7e-104 Ribosomal protein L11 family protein (.1) AT3G53430 294 / 1e-103 Ribosomal protein L11 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G145506 [exp] 320 / 5e-114 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.018G145504 [exp] 320 / 5e-114 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.018G146600 [exp] 320 / 5e-114 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1) Potri.018G145200 [exp] 320 / 5e-114 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037402 [exp] 309 / 1e-109 AT5G60670 300 / 4e-106 Ribosomal protein L11 family protein (.1) Lus10023186 [exp] 309 / 2e-109 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1) Lus10026506 [exp] 309 / 2e-109 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1) Lus10019935 [exp] 309 / 2e-109 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1) Lus10041308 [exp] 309 / 2e-109 AT5G60670 305 / 6e-108 Ribosomal protein L11 family protein (.1) Lus10015086 [exp] 141 / 2e-44 AT3G53430 134 / 5e-42 Ribosomal protein L11 family protein (.1) Lus10015085 [exp] 84 / 3e-22 AT5G60670 95 / 4e-27 Ribosomal protein L11 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00298 [poplar] [flax] Ribosomal_L11 Ribosomal protein L11, RNA binding domain PF03946 [poplar] [flax] Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.006G077200.1 pacid=42768527 polypeptide=Potri.006G077200.1.p locus=Potri.006G077200 ID=Potri.006G077200.1.v4.1 annot-version=v4.1 ATGCCGCCAAAGTTTGACCCATCTCAGGTTGTCGACGTTTTCGTCAGGGTGACGGGCGGTGAAGTTGGTGCGGCCAGTTCACTTGCTCCCAAAATCGGAC CGCTTGGTCTTTCTCCCAAGAAAATCGGTGAAGACATCGCCAAGGAGACAGCCAAGGACTGGAAGGGCCTCCGTGTCACCGTCAAGCTCACCGTCCAGAA CCGTCAAGCCAAGGTCACCGTCGTGCCCTCAGCAGCGGCTTTGGTTATCAAGGCGTTGAAGGAGCCAGAGAGAGACAGAAAGAAGACGAAGAACATAAAG CATAATGGGAACATCGCTCTTGATGATGTGATTGAGATTGCAAAGGTTATGAGTTCGAGATCAATGGCTAAGGATCTGAGTGGGACCGTGAAGGAGATTT TGGGGACTTGTGTTTCAGTTGGGTGTACGGTCGATGGGAAAGATCCAAAGGATTTGCAGCAGGAGATTACTGATGGTGATGTTGTGATTTCTGAATGA
AA sequence Show only first row Show all	>Potri.006G077200.1 pacid=42768527 polypeptide=Potri.006G077200.1.p locus=Potri.006G077200 ID=Potri.006G077200.1.v4.1 annot-version=v4.1 MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIK HNGNIALDDVIEIAKVMSSRSMAKDLSGTVKEILGTCVSVGCTVDGKDPKDLQQEITDGDVVISE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37190			Ribosomal protein L11 family p...		Potri.006G077200 [exp]	0	1	RPL12.4
AT3G02560			Ribosomal protein S7e family p...		Potri.004G099200 [exp]	2.23	0.9729
AT4G13170			Ribosomal protein L13 family p...		Potri.002G242600 [exp]	2.44	0.9711	Pt-RPL13.3
AT5G04800			Ribosomal S17 family protein (...		Potri.010G241200 [exp]	5.65	0.9686
AT4G16720			Ribosomal protein L23/L15e fam...		Potri.001G156100 [exp]	5.74	0.9695	RPL15.3
AT2G27710			60S acidic ribosomal protein f...		Potri.004G185800 [exp]	9.21	0.9615
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Potri.003G161200 [exp]	10.19	0.9329
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.001G304700 [exp]	11.22	0.9593	RPS16.3
AT2G27530		PGY1	PIGGYBACK1, Ribosomal protein ...		Potri.004G202832 [exp]	12.00	0.9606
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Potri.016G077200 [exp]	13.07	0.9545	UBQ1.3
AT4G15000			Ribosomal L27e protein family ...		Potri.006G021500 [exp]	13.26	0.9424	Pt-RPL27.2

Compare expression of checked genes

Potri.006G077200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.