Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-TOM7.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41685 75 / 1e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) AT1G64220 73 / 5e-19 TOM7-2 translocase of outer membrane 7 kDa subunit 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G146602 [exp] 107 / 2e-32 AT5G41685 78 / 9e-21 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.018G145502 [exp] 103 / 7e-31 AT5G41685 74 / 2e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001641 [exp] 87 / 3e-24 AT5G41685 85 / 1e-23 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10007843 [exp] 80 / 1e-21 AT5G41685 85 / 5e-24 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10000059 [exp] 80 / 2e-21 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10016473 [exp] 80 / 2e-21 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10040758 [exp] 79 / 2e-21 AT5G41685 88 / 7e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10004754 [exp] 79 / 3e-21 AT5G41685 81 / 3e-22 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08038 [poplar] [flax] Tom7 TOM7 family
Representative CDS sequence Show only first row Show all	>Potri.006G077500.1 pacid=42767591 polypeptide=Potri.006G077500.1.p locus=Potri.006G077500 ID=Potri.006G077500.1.v4.1 annot-version=v4.1 ATGGCGTCTAGGGTTTCTCTGAAGACAAAAGGCAAGAGCAGCAGCGGCAAGGGAGCAAAAGGCATGGAAGAGAAATCAGCGTCACAGTATTTCAAAGAAT GGAGCACATGGTCATTTAAAAAGGCCAAAGTTATCACTCACTATGGATTCATTCCTATGATTATTATCATTGGAATGAACTCTGAGCCTAAACCACAGAT TCATCAGCTCCTTAGTCCTTTCTGA
AA sequence Show only first row Show all	>Potri.006G077500.1 pacid=42767591 polypeptide=Potri.006G077500.1.p locus=Potri.006G077500 ID=Potri.006G077500.1.v4.1 annot-version=v4.1 MASRVSLKTKGKSSSGKGAKGMEEKSASQYFKEWSTWSFKKAKVITHYGFIPMIIIIGMNSEPKPQIHQLLSPF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G41685			Mitochondrial outer membrane t...		Potri.006G077500 [exp]	0	1	Pt-TOM7.2
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Potri.005G226300 [exp]	1.73	0.8254
AT1G31340		NEDD8, ATRUB1, ...	ARABIDOPSIS THALIANA RELATED T...		Potri.002G062500 [exp]	10.58	0.7584
AT2G46390		SDH8	succinate dehydrogenase 8, unk...		Potri.014G095901 [exp]	13.00	0.7361
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Potri.002G036500 [exp]	15.55	0.7427
AT3G11591			unknown protein		Potri.006G207600 [exp]	19.05	0.7719
AT5G55140			ribosomal protein L30 family p...		Potri.014G157400 [exp]	20.00	0.7690
AT5G56940			Ribosomal protein S16 family p...		Potri.004G217400 [exp]	22.58	0.7240	Pt-RPS16.2
AT2G01640			unknown protein		Potri.009G097000 [exp]	23.66	0.7264
AT3G06610			DNA-binding enhancer protein-r...		Potri.008G105000 [exp]	24.65	0.7550
AT1G51730			Ubiquitin-conjugating enzyme f...		Potri.001G199500 [exp]	27.12	0.6936

Compare expression of checked genes

Potri.006G077500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.