Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PBA1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31300 416 / 2e-149 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 109 / 9e-29 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 108 / 3e-28 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G13060 100 / 2e-25 PBE1 20S proteasome beta subunit E1 (.1.2) AT3G26340 93 / 2e-22 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT3G60820 64 / 3e-12 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT4G14800 63 / 6e-12 PBD2 20S proteasome beta subunit D2 (.1.2) AT3G22630 61 / 2e-11 PRCGB, PBD1 20S proteasome beta subunit D1 (.1) AT3G14290 52 / 7e-08 PAE2 20S proteasome alpha subunit E2 (.1) AT1G53850 51 / 1e-07 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G145900 [exp] 454 / 2e-164 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.017G071100 [exp] 105 / 3e-27 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3) Potri.004G066000 [exp] 103 / 1e-26 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.010G058100 [exp] 93 / 2e-22 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.008G177000 [exp] 92 / 3e-22 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.014G069800 [exp] 66 / 6e-13 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.002G148300 [exp] 62 / 1e-11 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.001G162900 [exp] 51 / 1e-07 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.018G037700 [exp] 49 / 6e-07 AT1G56450 407 / 5e-146 20S proteasome beta subunit G1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020180 [exp] 419 / 8e-151 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10026984 [exp] 345 / 1e-119 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10014581 [exp] 112 / 2e-29 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3) Lus10032102 [exp] 110 / 5e-29 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10006426 [exp] 90 / 2e-21 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10011369 [exp] 90 / 3e-21 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10041194 [exp] 66 / 6e-13 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1) Lus10015867 [exp] 66 / 8e-13 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10039351 [exp] 64 / 3e-12 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10009294 [exp] 57 / 3e-09 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF00227 [poplar] [flax] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Potri.006G077900.1 pacid=42767325 polypeptide=Potri.006G077900.1.p locus=Potri.006G077900 ID=Potri.006G077900.1.v4.1 annot-version=v4.1 ATGGAATCACACGAGGAAAGTGAGATCAATGGCCCTCATTCCATGGGTACCACCATCATCGGCGTCACTTATAACGGTGGTGTCGTCCTCGGTGCCGATT CTCGCACCAGCACAGGAATTTATGTTGCAAATCGAGCATCTGATAAAATCACTCAGCTAACTGATAATGTCTACTTATGCCGTTCTGGATCTGCAGCGGA TTCTCAAACTGTGTCTGATTATGTGAGATATTTTCTTCATCAGCACACGATACAATTGGGGCAACCGGCGACAGTTAAGGTTGCTGCTAACCTTGTTAGG CTGTTGTCTTACAGTAACAAGAATATGTTGCAAACTGGAATGATTATCGGGGGTTGGGATAAGTATGAAGGAGGTAAAATTTATGGAGTGCCTCTTGGAG GAACACTTTTGGAGCTGCCGTTTACTATTGGAGGTTCAGGATCCACTTACTTGTATGGTTTCTTTGATCAAGCATGGAAGGAAGGGATGACCCAAGAAGA AGCTGAGCAATTAGTGGTGAAAGCAGTCTCTCTTGCTATTGCTCGTGATGGTGCAAGTGGTGGTGTTGTTCGGACTGTCACTATAAACTCAGAAGGCGTG ACAAGAAAGTACTATCCTGAGGACAAGCTCCCCCGATGGCATGAGGAGCTGGAGCCACAGAACTCATTGTTGGACATATTGTCATCATCCAGTCCCGAGC CAATGGTTTCTTGA
AA sequence Show only first row Show all	>Potri.006G077900.1 pacid=42767325 polypeptide=Potri.006G077900.1.p locus=Potri.006G077900 ID=Potri.006G077900.1.v4.1 annot-version=v4.1 MESHEESEINGPHSMGTTIIGVTYNGGVVLGADSRTSTGIYVANRASDKITQLTDNVYLCRSGSAADSQTVSDYVRYFLHQHTIQLGQPATVKVAANLVR LLSYSNKNMLQTGMIIGGWDKYEGGKIYGVPLGGTLLELPFTIGGSGSTYLYGFFDQAWKEGMTQEEAEQLVVKAVSLAIARDGASGGVVRTVTINSEGV TRKYYPEDKLPRWHEELEPQNSLLDILSSSSPEPMVS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G31300		PBA1	N-terminal nucleophile aminohy...		Potri.006G077900 [exp]	0	1	PBA1.2
AT5G03300		ADK2	adenosine kinase 2 (.1)		Potri.010G224300 [exp]	1.41	0.9481	ADK2.2
AT1G63120		ATRBL2	RHOMBOID-like 2 (.1)		Potri.001G108700 [exp]	3.46	0.9337
AT3G13410			unknown protein		Potri.001G000900 [exp]	4.24	0.9366
AT1G76550			Phosphofructokinase family pro...		Potri.005G257800 [exp]	4.47	0.9407
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.009G028100 [exp]	6.32	0.9203	ADF6,Pt-ADF.6
AT3G56190		ASNAP, ALPHA-SN...	alpha-soluble NSF attachment p...		Potri.008G075400 [exp]	6.70	0.9145	ASNAP.1
AT1G63000		UER1, NRS/ER	"UDP-4-KETO-6-DEOXY-D-GLUCOSE-...		Potri.003G120000 [exp]	7.74	0.9199
AT5G26667		PYR6	P-loop containing nucleoside t...		Potri.002G134600 [exp]	10.19	0.9170
AT1G20010		TUB5	tubulin beta-5 chain (.1)		Potri.002G021800 [exp]	10.24	0.9080
AT5G37310			Endomembrane protein 70 protei...		Potri.017G144241 [exp]	11.48	0.9280

Compare expression of checked genes

Potri.006G077900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.