Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30490 99 / 6e-26 REF3, CYP73A5, ATC4H REDUCED EPRDERMAL FLUORESCENCE 3, CINNAMATE 4-HYDROXYLASE, cinnamate-4-hydroxylase (.1) AT3G26210 47 / 1e-07 CYP71B23 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) AT1G74550 46 / 2e-07 CYP98A9 cytochrome P450, family 98, subfamily A, polypeptide 9 (.1) AT5G06905 44 / 1e-06 CYP712A2 "cytochrome P450, family 712, subfamily A, polypeptide 2", cytochrome P450, family 712, subfamily A, polypeptide 2 (.1) AT3G26270 44 / 1e-06 CYP71B25 "cytochrome P450, family 71, subfamily B, polypeptide 25", cytochrome P450, family 71, subfamily B, polypeptide 25 (.1) AT5G07990 44 / 2e-06 CYP75B1, D501, TT7 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) AT3G26830 44 / 2e-06 CYP71B15, PAD3 PHYTOALEXIN DEFICIENT 3, Cytochrome P450 superfamily protein (.1) AT3G26230 43 / 3e-06 CYP71B24 "cytochrome P450, family 71, subfamily B, polypeptide 24", cytochrome P450, family 71, subfamily B, polypeptide 24 (.1) AT1G13090 43 / 4e-06 CYP71B28 "cytochrome P450, family 71, subfamily B, polypeptide 28", cytochrome P450, family 71, subfamily B, polypeptide 28 (.1) AT1G13110 43 / 4e-06 CYP71B7 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G146100 [exp] 130 / 2e-37 AT2G30490 622 / 0.0 REDUCED EPRDERMAL FLUORESCENCE 3, CINNAMATE 4-HYDROXYLASE, cinnamate-4-hydroxylase (.1) Potri.019G130700 [exp] 99 / 6e-26 AT2G30490 812 / 0.0 REDUCED EPRDERMAL FLUORESCENCE 3, CINNAMATE 4-HYDROXYLASE, cinnamate-4-hydroxylase (.1) Potri.013G157900 [exp] 95 / 1e-24 AT2G30490 826 / 0.0 REDUCED EPRDERMAL FLUORESCENCE 3, CINNAMATE 4-HYDROXYLASE, cinnamate-4-hydroxylase (.1) Potri.016G052600 [exp] 50 / 7e-09 AT2G42250 512 / 2e-178 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Potri.006G058200 [exp] 47 / 2e-07 AT5G06900 584 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.010G227301 [exp] 44 / 9e-07 AT2G42250 213 / 3e-67 "cytochrome P450, family 712, subfamily A, polypeptide 1", cytochrome P450, family 712, subfamily A, polypeptide 1 (.1) Potri.008G184400 [exp] 44 / 1e-06 AT3G26320 535 / 0.0 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1) Potri.008G223500 [exp] 44 / 3e-06 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.008G184000 [exp] 43 / 5e-06 AT3G26320 535 / 0.0 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027598 [exp] 127 / 3e-36 AT2G30490 630 / 0.0 REDUCED EPRDERMAL FLUORESCENCE 3, CINNAMATE 4-HYDROXYLASE, cinnamate-4-hydroxylase (.1) Lus10021671 [exp] 106 / 9e-29 AT2G30490 778 / 0.0 REDUCED EPRDERMAL FLUORESCENCE 3, CINNAMATE 4-HYDROXYLASE, cinnamate-4-hydroxylase (.1) Lus10035011 [exp] 105 / 2e-28 AT2G30490 867 / 0.0 REDUCED EPRDERMAL FLUORESCENCE 3, CINNAMATE 4-HYDROXYLASE, cinnamate-4-hydroxylase (.1) Lus10034449 [exp] 89 / 2e-22 AT2G30490 882 / 0.0 REDUCED EPRDERMAL FLUORESCENCE 3, CINNAMATE 4-HYDROXYLASE, cinnamate-4-hydroxylase (.1) Lus10019110 [exp] 77 / 4e-18 AT2G30490 555 / 0.0 REDUCED EPRDERMAL FLUORESCENCE 3, CINNAMATE 4-HYDROXYLASE, cinnamate-4-hydroxylase (.1) Lus10041667 [exp] 46 / 3e-07 AT3G26300 375 / 3e-125 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10027798 [exp] 45 / 1e-06 AT5G06900 349 / 1e-117 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10035502 [exp] 42 / 1e-05 AT5G06900 533 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10020850 [exp] 42 / 1e-05 AT2G40890 666 / 0.0 cytochrome P450, family 98, subfamily A, polypeptide 3 (.1) Lus10028881 [exp] 40 / 3e-05 AT2G45550 477 / 4e-165 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.006G078101.1 pacid=42768223 polypeptide=Potri.006G078101.1.p locus=Potri.006G078101 ID=Potri.006G078101.1.v4.1 annot-version=v4.1 ATGGAGAGAAGCTGCGCCATGGATCACATGATTCATGCTCAAATGAAAGGAGTAACCAGTGAAGAAAATGTACTTTACATTGCAGAGAACATTAATGTTG CTGGTATAGAGACTGCATTGTGGTCCATTGCTGAACTGGTTAATCATCCAACCGTTCAGAAGAAGATCAGAGATGAAATCACAACCGTCCTAAAGGGAAA TCCAGTCACGGAATCTAACCTGCATGAACTGCCATATTAG
AA sequence Show only first row Show all	>Potri.006G078101.1 pacid=42768223 polypeptide=Potri.006G078101.1.p locus=Potri.006G078101 ID=Potri.006G078101.1.v4.1 annot-version=v4.1 MERSCAMDHMIHAQMKGVTSEENVLYIAENINVAGIETALWSIAELVNHPTVQKKIRDEITTVLKGNPVTESNLHELPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30490		REF3, CYP73A5, ...	REDUCED EPRDERMAL FLUORESCENCE...		Potri.006G078101 [exp]	0	1
AT2G44740		CYCP4;1	cyclin p4;1 (.1)		Potri.015G112140 [exp]	6.24	0.9357
AT5G19760			Mitochondrial substrate carrie...		Potri.001G004366 [exp]	6.40	0.9530
					Potri.012G026150 [exp]	13.78	0.9464
AT4G10260			pfkB-like carbohydrate kinase ...		Potri.019G063600 [exp]	15.09	0.9429
					Potri.001G004432 [exp]	19.07	0.9351
					Potri.001G006250 [exp]	25.98	0.8165
AT5G11190	AP2_ERF	SHN2, SHN3	shine2, Integrase-type DNA-bin...		Potri.018G028000 [exp]	26.83	0.8099
					Potri.006G127750 [exp]	27.11	0.9255
AT1G62680			Pentatricopeptide repeat (PPR)...		Potri.019G099701 [exp]	27.65	0.9344
AT1G79360		2-Oct, ATOCT2	ORGANIC CATION TRANSPORTER 2, ...		Potri.010G174300 [exp]	29.66	0.9026

Compare expression of checked genes

Potri.006G078101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.