Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13640 42 / 1e-05 GARP UNE16 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) AT1G69580 39 / 7e-05 GARP Homeodomain-like superfamily protein (.1.2) AT3G24120 39 / 8e-05 GARP Homeodomain-like superfamily protein (.1.2) AT3G13040 38 / 0.0002 GARP myb-like HTH transcriptional regulator family protein (.1.2) AT3G04030 38 / 0.0002 GARP Homeodomain-like superfamily protein (.1.2.3) AT4G28610 37 / 0.0005 GARP ATPHR1, PHR1 phosphate starvation response 1 (.1) AT2G01060 37 / 0.0006 GARP myb-like HTH transcriptional regulator family protein (.1.2) AT5G18240 37 / 0.0008 GARP MYR1, ATMYR1 ARABIDOPSIS MYB-RELATED PROTEIN 1, myb-related protein 1 (.1.2.3.4.5) AT5G29000 36 / 0.001 GARP PHL1 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G151400 [exp] 68 / 5e-15 AT3G13040 176 / 4e-50 myb-like HTH transcriptional regulator family protein (.1.2) Potri.013G060200 [exp] 41 / 2e-05 AT3G04030 462 / 3e-162 Homeodomain-like superfamily protein (.1.2.3) Potri.017G054800 [exp] 41 / 2e-05 AT4G13640 338 / 6e-117 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) Potri.007G003200 [exp] 40 / 6e-05 AT3G13040 330 / 1e-108 myb-like HTH transcriptional regulator family protein (.1.2) Potri.014G000700 [exp] 39 / 8e-05 AT3G13040 308 / 6e-101 myb-like HTH transcriptional regulator family protein (.1.2) Potri.001G314800 [exp] 39 / 8e-05 AT4G13640 345 / 2e-119 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) Potri.019G032700 [exp] 38 / 0.0002 AT3G04030 449 / 2e-157 Homeodomain-like superfamily protein (.1.2.3) Potri.013G048000 [exp] 37 / 0.0006 AT5G29000 321 / 4e-106 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) Potri.002G257800 [exp] 37 / 0.0007 AT4G28610 332 / 6e-110 phosphate starvation response 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040583 [exp] 47 / 3e-07 AT3G13040 155 / 9e-43 myb-like HTH transcriptional regulator family protein (.1.2) Lus10028102 [exp] 46 / 4e-07 AT3G13040 155 / 6e-44 myb-like HTH transcriptional regulator family protein (.1.2) Lus10040569 [exp] 45 / 5e-07 AT3G13040 157 / 7e-44 myb-like HTH transcriptional regulator family protein (.1.2) Lus10037296 [exp] 39 / 8e-05 AT3G13040 364 / 5e-122 myb-like HTH transcriptional regulator family protein (.1.2) Lus10035705 [exp] 39 / 8e-05 AT3G13040 372 / 4e-125 myb-like HTH transcriptional regulator family protein (.1.2) Lus10032778 [exp] 39 / 0.0002 AT5G29000 272 / 2e-87 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) Lus10007132 [exp] 38 / 0.0003 AT4G13640 390 / 3e-137 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) Lus10016676 [exp] 38 / 0.0003 AT4G13640 380 / 2e-133 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) Lus10020264 [exp] 38 / 0.0003 AT3G04030 441 / 4e-154 Homeodomain-like superfamily protein (.1.2.3) Lus10002629 [exp] 38 / 0.0003 AT3G04030 440 / 9e-154 Homeodomain-like superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF14379 [poplar] [flax] Myb_CC_LHEQLE MYB-CC type transfactor, LHEQLE motif
Representative CDS sequence Show only first row Show all	>Potri.006G081001.1 pacid=42768694 polypeptide=Potri.006G081001.1.p locus=Potri.006G081001 ID=Potri.006G081001.1.v4.1 annot-version=v4.1 ATGGAAAAAAAAATAAATTCTTCAGATACTCTGCATGCTCTCAGAGATCAAATACTTCCAAACAGAAGCACTCCCACCATTGCAGAGAAGAATGAAGCTT CATCGTCGGGCAATGACAATGATGCACGTGTCAATGAGCCCAACAGAGACTTGCGAGTAACAGAGGCTTTGCGCACACAAATTGAAATTCAAAAGCTGCT GCATGAGCAGCTTAAGGTGCCTCGATGCCTTCTAGTCATCATGTTGTAA
AA sequence Show only first row Show all	>Potri.006G081001.1 pacid=42768694 polypeptide=Potri.006G081001.1.p locus=Potri.006G081001 ID=Potri.006G081001.1.v4.1 annot-version=v4.1 MEKKINSSDTLHALRDQILPNRSTPTIAEKNEASSSGNDNDARVNEPNRDLRVTEALRTQIEIQKLLHEQLKVPRCLLVIML

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13640	GARP	UNE16	unfertilized embryo sac 16, Ho...		Potri.006G081001 [exp]	0	1
AT5G01030			Protein of unknown function (D...		Potri.016G105500 [exp]	2.44	0.9863
					Potri.009G034001 [exp]	3.16	0.9847
AT5G22470			NAD+ ADP-ribosyltransferases;N...		Potri.004G184100 [exp]	4.00	0.9862
AT2G45380			unknown protein		Potri.014G069100 [exp]	8.24	0.9733
AT4G10570		UBP9	ubiquitin-specific protease 9 ...		Potri.001G449000 [exp]	8.36	0.9786
AT5G03420			5'-AMP-activated protein kinas...		Potri.006G123300 [exp]	9.59	0.9680
AT1G30070			SGS domain-containing protein ...		Potri.011G085100 [exp]	9.94	0.9631
AT3G08970		TMS1, ATERDJ3A	THERMOSENSITIVE MALE STERILE 1...		Potri.016G120000 [exp]	9.94	0.9785
AT5G63830			HIT-type Zinc finger family pr...		Potri.001G085800 [exp]	10.09	0.9623
AT1G23100			GroES-like family protein (.1)		Potri.008G130500 [exp]	10.95	0.9651

Compare expression of checked genes

Potri.006G081001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.