Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37530 94 / 1e-25 unknown protein AT1G07795 74 / 5e-18 unknown protein AT2G28725 66 / 5e-15 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024416 [exp] 88 / 2e-23 AT2G37530 105 / 2e-30 unknown protein Lus10025320 [exp] 84 / 9e-22 AT2G37530 99 / 5e-28 unknown protein Lus10023761 [exp] 79 / 3e-20 AT1G07795 89 / 5e-24 unknown protein Lus10005894 [exp] 62 / 3e-13 AT1G07795 97 / 5e-27 unknown protein Lus10040852 [exp] 62 / 4e-13 AT1G07795 97 / 4e-27 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G083800.1 pacid=42769973 polypeptide=Potri.006G083800.1.p locus=Potri.006G083800 ID=Potri.006G083800.1.v4.1 annot-version=v4.1 ATGATGTCTCTCCCCTTCACATCTCTCCGCCATCGGCTTTCATGGCCTCTGATACTCTATTCTGCTACATGGACGTCTCTCCTAACGCTGACAGTGGCAG TGGCCTCGTTCTCCCCCGAGTTTGCATTTGTATTGACAATATCTTCGTTTTCGCAAGGGTGTGAACAGGAGGGGACTGTTAGAGTTCCACTAGACGTGCC AGGAGAGGTCATGTGCTTGCCCGCTCACCTCTTCAAAAGGTCTCCTGTGACTGATTCCATTGTTTCTCTCCTCTTTGCAGCGCTAGTGGTTGCTGTCTCA GCCTGGGTGGTTCGAGCCATGGGCTTGTGGGAGGACGATGAGGCCACCCTCTAA
AA sequence Show only first row Show all	>Potri.006G083800.1 pacid=42769973 polypeptide=Potri.006G083800.1.p locus=Potri.006G083800 ID=Potri.006G083800.1.v4.1 annot-version=v4.1 MMSLPFTSLRHRLSWPLILYSATWTSLLTLTVAVASFSPEFAFVLTISSFSQGCEQEGTVRVPLDVPGEVMCLPAHLFKRSPVTDSIVSLLFAALVVAVS AWVVRAMGLWEDDEATL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37530			unknown protein		Potri.006G083800 [exp]	0	1
AT4G39230			NmrA-like negative transcripti...		Potri.007G036500 [exp]	3.00	0.9345	PCBER5
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G063200 [exp]	5.65	0.9242
AT5G56450		PM-ANT	Mitochondrial substrate carrie...		Potri.018G062350 [exp]	6.85	0.8442
					Potri.017G110800 [exp]	8.83	0.8741
					Potri.003G010664 [exp]	10.81	0.9203
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G064100 [exp]	10.95	0.9216
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G063101 [exp]	11.22	0.9208
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G063051 [exp]	11.31	0.9206
AT3G08510		ATPLC2	phospholipase C 2 (.1.2.3)		Potri.001G252104 [exp]	12.24	0.7965
AT5G39130			RmlC-like cupins superfamily p...		Potri.013G062950 [exp]	14.69	0.9146

Compare expression of checked genes

Potri.006G083800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.