Potri.006G084300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03905 199 / 2e-66 Iron-sulphur cluster biosynthesis family protein (.1)
AT1G10500 79 / 7e-19 ATCPISCA chloroplast-localized ISCA-like protein (.1)
AT2G16710 64 / 9e-14 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
AT2G36260 59 / 6e-12 Iron-sulphur cluster biosynthesis family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G085400 74 / 3e-17 AT1G10500 227 / 9e-77 chloroplast-localized ISCA-like protein (.1)
Potri.007G079600 74 / 7e-17 AT1G10500 210 / 5e-70 chloroplast-localized ISCA-like protein (.1)
Potri.010G238800 67 / 6e-15 AT2G16710 211 / 2e-71 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Potri.008G020400 62 / 8e-13 AT2G16710 197 / 5e-66 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014201 196 / 3e-65 AT5G03905 204 / 2e-68 Iron-sulphur cluster biosynthesis family protein (.1)
Lus10022714 195 / 1e-64 AT5G03905 201 / 3e-67 Iron-sulphur cluster biosynthesis family protein (.1)
Lus10020827 71 / 1e-15 AT1G10500 216 / 1e-72 chloroplast-localized ISCA-like protein (.1)
Lus10012683 70 / 2e-15 AT1G10500 218 / 2e-73 chloroplast-localized ISCA-like protein (.1)
Lus10017048 53 / 3e-09 AT2G16710 220 / 5e-75 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
Lus10021368 42 / 4e-05 AT2G16710 211 / 3e-69 Iron-sulphur cluster biosynthesis family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01521 Fe-S_biosyn Iron-sulphur cluster biosynthesis
Representative CDS sequence
>Potri.006G084300.2 pacid=42768481 polypeptide=Potri.006G084300.2.p locus=Potri.006G084300 ID=Potri.006G084300.2.v4.1 annot-version=v4.1
ATGATGTCTTCCAAATCATCATCGTTGATTAAACGGGTAACACCCTTGTTCACTTCTTGGATTCGACAGAACCACAGGCTTCTTAGCTCTTCTGCTCTTC
GCGAAGCTTCTACTCTTGTTGATGATTCCATTCACTTGACCGACAATTGCATCCGGAGACTGAAAGAACTGCAAACCAGTGAAGGATCGGCTAAAGACAA
AATGCTTCGTTTGGGTGTGGAAACTGGTGGATGTTCTGGTTTCCAGTATGTTTTTGACTTGGATGATAAAACCAATCCAGATGACAGAGTTTTTGAGACA
GAAGGAGTCAGATTGGTGGTTGATAACATTTCATATGATTTTCTGAAAGGGGCCACTGTTGACTATGTTGAGGAGCTAATCCGTGCTGCTTTTATAGTGG
CCACCAATCCAAGTGCAGTGGGCGGGTGCAGTTGTAAAAGTTCTTTCATGGTGAAACAGTAA
AA sequence
>Potri.006G084300.2 pacid=42768481 polypeptide=Potri.006G084300.2.p locus=Potri.006G084300 ID=Potri.006G084300.2.v4.1 annot-version=v4.1
MMSSKSSSLIKRVTPLFTSWIRQNHRLLSSSALREASTLVDDSIHLTDNCIRRLKELQTSEGSAKDKMLRLGVETGGCSGFQYVFDLDDKTNPDDRVFET
EGVRLVVDNISYDFLKGATVDYVEELIRAAFIVATNPSAVGGCSCKSSFMVKQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G03905 Iron-sulphur cluster biosynthe... Potri.006G084300 0 1
AT1G79810 PEX2, TED3, ATP... ARABIDOPSIS PEROXIN 2, Pex2/Pe... Potri.003G051500 1.41 0.9122 TED3.1
AT5G19590 Protein of unknown function, D... Potri.006G158952 7.21 0.8844
AT2G17390 AKR2B ankyrin repeat-containing 2B (... Potri.004G210000 34.20 0.8670 Pt-AKR2.1
AT3G17609 bZIP HYH HY5-homolog (.1.2.3.4) Potri.010G004200 35.32 0.8690 HY5.1
AT5G06140 ATSNX1 ARABIDOPSIS THALIANA SORTING N... Potri.006G209600 35.70 0.8546
AT5G24165 unknown protein Potri.012G011600 36.00 0.8180
AT1G55340 Protein of unknown function (D... Potri.013G057600 36.98 0.8066
AT2G05620 PGR5 proton gradient regulation 5 (... Potri.008G171000 48.06 0.8630 PGR5.2
AT1G34300 lectin protein kinase family p... Potri.013G096300 50.99 0.8315
AT3G12800 SDRB, DECR short-chain dehydrogenase-redu... Potri.012G125900 52.96 0.8356

Potri.006G084300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.