Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09390 59 / 2e-13 ATMT-K, ATMT-1, MT2A ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) AT5G02380 55 / 8e-12 MT2B metallothionein 2B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G030800 [exp] 74 / 3e-19 AT3G09390 64 / 2e-15 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.019G100001 [exp] 70 / 2e-17 AT3G09390 64 / 4e-15 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.013G131200 [exp] 66 / 3e-16 AT3G09390 62 / 2e-14 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.001G239650 [exp] 66 / 6e-16 AT3G09390 60 / 1e-13 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.001G041268 [exp] 65 / 1e-15 AT3G09390 42 / 1e-06 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.001G040200 [exp] 65 / 1e-15 AT3G09390 42 / 1e-06 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025350 [exp] 60 / 1e-13 AT5G02380 51 / 3e-10 metallothionein 2B (.1) Lus10024396 [exp] 59 / 3e-13 AT5G02380 50 / 1e-09 metallothionein 2B (.1) Lus10025349 [exp] 61 / 3e-12 AT5G02370 536 / 0.0 ATP binding microtubule motor family protein (.1) Lus10016546 [exp] 52 / 2e-10 AT5G02380 40 / 5e-06 metallothionein 2B (.1) Lus10040811 [exp] 44 / 3e-07 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01439 [poplar] [flax] Metallothio_2 Metallothionein
Representative CDS sequence Show only first row Show all	>Potri.006G085200.2 pacid=42768835 polypeptide=Potri.006G085200.2.p locus=Potri.006G085200 ID=Potri.006G085200.2.v4.1 annot-version=v4.1 ATGTCTTGCTGTGGAGGAAACTGTGGGTGTGGCTCTGGCTGCAAGTGCGGCAGCGGCTGTGGAGGATGCAAGATGTACCCTGACATGAGCTCCTCAGAGA CGATCACCAACGAAACTCTGGTTCTTGGTGTGGCACCAGAGAAGGGTCACTTTGCGGGAGCTGCTGAGACGGTCGTGGGAGCCGAGAATGGCTGCAAGTG TGGAGCCAACTGTACCTGCGATCCTTGCACTTGTAAATGA
AA sequence Show only first row Show all	>Potri.006G085200.2 pacid=42768835 polypeptide=Potri.006G085200.2.p locus=Potri.006G085200 ID=Potri.006G085200.2.v4.1 annot-version=v4.1 MSCCGGNCGCGSGCKCGSGCGGCKMYPDMSSSETITNETLVLGVAPEKGHFAGAAETVVGAENGCKCGANCTCDPCTCK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09390		ATMT-K, ATMT-1,...	ARABIDOPSIS THALIANA METALLOTH...		Potri.006G085200 [exp]	0	1
AT1G16850			unknown protein		Potri.010G252700 [exp]	1.41	0.9002
AT4G19390			Uncharacterised protein family...		Potri.004G234600 [exp]	5.74	0.9166
AT5G03560			Tetratricopeptide repeat (TPR)...		Potri.016G096900 [exp]	16.43	0.8943
AT3G20970		ATNFU2, NFU4	ARABIDOPSIS THALIANA NFU DOMAI...		Potri.008G022000 [exp]	18.49	0.8763
AT1G26850			S-adenosyl-L-methionine-depend...		Potri.012G069000 [exp]	23.68	0.8617
AT1G68300			Adenine nucleotide alpha hydro...		Potri.010G123200 [exp]	26.07	0.8602
AT1G53920		GLIP5	GDSL-motif lipase 5 (.1)		Potri.018G063901 [exp]	29.74	0.8774
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Potri.002G028700 [exp]	32.72	0.8763	VFCYSPRO.1
AT4G21580			oxidoreductase, zinc-binding d...		Potri.004G036100 [exp]	33.98	0.8161
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Potri.007G003100 [exp]	42.26	0.8606

Compare expression of checked genes

Potri.006G085200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.