Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37660 451 / 2e-160 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G02240 406 / 6e-144 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G31530 92 / 3e-21 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT2G34460 81 / 4e-17 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT3G18890 70 / 4e-13 AtTic62 translocon at the inner envelope membrane of chloroplasts 62, NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G16720 54 / 7e-08 HCF173 high chlorophyll fluorescence phenotype 173 (.1) AT4G18810 49 / 3e-06 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT1G80820 44 / 6e-05 CCR2, ATCCR2 cinnamoyl coa reductase (.1) AT1G15950 42 / 0.0003 IRX4, ATCCR1, CCR1 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2) AT2G33590 42 / 0.0003 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G253900 [exp] 80 / 8e-17 AT4G31530 399 / 1e-139 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.004G150300 [exp] 73 / 4e-14 AT3G18890 481 / 1e-164 translocon at the inner envelope membrane of chloroplasts 62, NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.T124404 [exp] 71 / 2e-13 AT3G18890 541 / 0.0 translocon at the inner envelope membrane of chloroplasts 62, NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.009G111323 [exp] 71 / 2e-13 AT3G18890 541 / 0.0 translocon at the inner envelope membrane of chloroplasts 62, NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.011G079600 [exp] 64 / 2e-11 AT2G34460 370 / 6e-130 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.014G000400 [exp] 55 / 3e-08 AT1G16720 863 / 0.0 high chlorophyll fluorescence phenotype 173 (.1) Potri.007G003500 [exp] 52 / 3e-07 AT1G16720 852 / 0.0 high chlorophyll fluorescence phenotype 173 (.1) Potri.003G063800 [exp] 50 / 1e-06 AT1G72640 348 / 1e-120 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.004G183100 [exp] 49 / 2e-06 AT4G35250 650 / 0.0 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010846 [exp] 466 / 1e-166 AT2G37660 451 / 2e-160 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10024383 [exp] 464 / 7e-166 AT2G37660 458 / 1e-163 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10009715 [exp] 86 / 4e-19 AT4G31530 408 / 1e-144 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Lus10022420 [exp] 86 / 7e-19 AT4G31530 415 / 4e-146 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Lus10040884 [exp] 74 / 1e-14 AT2G34460 401 / 7e-142 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10004936 [exp] 73 / 2e-14 AT2G34460 399 / 4e-141 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10042346 [exp] 67 / 6e-12 AT3G18890 483 / 2e-164 translocon at the inner envelope membrane of chloroplasts 62, NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10026321 [exp] 64 / 5e-11 AT3G18890 479 / 6e-163 translocon at the inner envelope membrane of chloroplasts 62, NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10034781 [exp] 55 / 4e-08 AT1G16720 870 / 0.0 high chlorophyll fluorescence phenotype 173 (.1) Lus10033322 [exp] 55 / 4e-08 AT1G16720 874 / 0.0 high chlorophyll fluorescence phenotype 173 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF13460 [poplar] [flax] NAD_binding_10 NAD(P)H-binding
Representative CDS sequence Show only first row Show all	>Potri.006G086800.1 pacid=42769567 polypeptide=Potri.006G086800.1.p locus=Potri.006G086800 ID=Potri.006G086800.1.v4.1 annot-version=v4.1 ATGACAACCACCGTCACCGTGACACGTGTTCCATTGATTTTCTCCGGTCATTTTCTTAATAATAAAAACGGGCGTGCTTCACAATCGGCCGTACACCTTT TAGGTAGCATTAGCAATAGCAATACTAGCAGTGCTAGTCGTAGCTCATTTTCTTCGTCACTAACAGCAACAACGCGCATAAGGAGAGCAGGGTTCGCTGT ATTAGCTTCAAATTCAATGGCTCCAAGCATTGTCCTTGTCACTGGAGCTGGTGGCAGAACTGGTTCCATAGTTTATAAGAAACTGAAGGAGAGGTCTGAA CAATATGTTGCAAGGGGTTTGGTAAGAACTGAAGAGAGCAAGGAGAAAATTGGAGGAGCTGAGGATGTTTTTGTTGGGGATATAAGGGAATCCAAAAGCA TTGTTCCTGCGATCCAAGGAATTGATTCTCTGATCATCCTGACAAGTGCAGTGCCAAAGATGAAACCTGGGTCTGATCCATCCAAAGGCAGGCCTGAGTT CTATTTTGAAGATGGAGCATTTCCTGAGCAGGTTGACTGGATTGGTCAGAAAAATCAAATAGATGCTGCTAAGGCCGCAGGAGTTAAGCAAATTGTGCTG GTTGGATCTATGGGTGGAACAAACCTAAATCATCCCTTGAACAGTTTGGGTAATGGGAATATACTGGTTTGGAAGAGAAAGGCTGAGCAGTATTTGGCCG ACTCTGGTGTTCCATACACAATTCTAAGGGCTGGAGGCCTGCAAGACAAAGAAGGAGGTGTCCGAGAATTACTTGTTGGAAAAGATGACGAGCTTCTTCA GACAGAGACAAGAACCATTGCCAGAGCTGATGTTGCAGAAGTCTGCATTCAGGCACTACAGTACGAAGAGGCTCAATTTAAGGCATTTGATCTGGCCTCA AAACCAGAGGGAACTGGCACCCCAGCCAATGATTTTAAGGCTCTCTTTTCTCAAGTCACTGCTCGTTTTTGA
AA sequence Show only first row Show all	>Potri.006G086800.1 pacid=42769567 polypeptide=Potri.006G086800.1.p locus=Potri.006G086800 ID=Potri.006G086800.1.v4.1 annot-version=v4.1 MTTTVTVTRVPLIFSGHFLNNKNGRASQSAVHLLGSISNSNTSSASRSSFSSSLTATTRIRRAGFAVLASNSMAPSIVLVTGAGGRTGSIVYKKLKERSE QYVARGLVRTEESKEKIGGAEDVFVGDIRESKSIVPAIQGIDSLIILTSAVPKMKPGSDPSKGRPEFYFEDGAFPEQVDWIGQKNQIDAAKAAGVKQIVL VGSMGGTNLNHPLNSLGNGNILVWKRKAEQYLADSGVPYTILRAGGLQDKEGGVRELLVGKDDELLQTETRTIARADVAEVCIQALQYEEAQFKAFDLAS KPEGTGTPANDFKALFSQVTARF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37660			NAD(P)-binding Rossmann-fold s...		Potri.006G086800 [exp]	0	1
AT4G13010			Oxidoreductase, zinc-binding d...		Potri.001G342800 [exp]	3.00	0.9092
AT4G30950		FADC, SFD4, FAD...	STEAROYL DESATURASE DEFICIENCY...		Potri.006G185400 [exp]	4.35	0.9292
AT1G33110			MATE efflux family protein (.1...		Potri.013G069700 [exp]	4.89	0.9287
AT3G51860		CAX1-LIKE, ATHC...	cation exchanger 3 (.1)		Potri.006G099900 [exp]	9.79	0.9057	CAX3.1
AT4G37470			alpha/beta-Hydrolases superfam...		Potri.007G052000 [exp]	10.09	0.9107
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Potri.016G040200 [exp]	15.87	0.9231	LYC.2
AT3G13540	MYB	ATMYB5, ATM2	myb domain protein 5 (.1)		Potri.001G005100 [exp]	17.54	0.9006
AT1G01050		ATPPA1	pyrophosphorylase 1 (.1)		Potri.007G022700 [exp]	19.33	0.8408
AT4G15920		SWEET17, AtSWEE...	Nodulin MtN3 family protein (....		Potri.008G220600 [exp]	20.34	0.9001
AT3G27160		GHS1	GLUCOSE HYPERSENSITIVE 1, Ribo...		Potri.001G331600 [exp]	22.71	0.9205	GHS1.1

Compare expression of checked genes

Potri.006G086800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.