Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02190 234 / 6e-76 EMB24, ATASP38, PCS1 PROMOTION OF CELL SURVIVAL 1, EMBRYO DEFECTIVE 24, ARABIDOPSIS THALIANA ASPARTIC PROTEASE 38, Eukaryotic aspartyl protease family protein (.1) AT2G39710 217 / 3e-69 Eukaryotic aspartyl protease family protein (.1) AT1G66180 124 / 1e-33 Eukaryotic aspartyl protease family protein (.1) AT5G37540 111 / 4e-29 Eukaryotic aspartyl protease family protein (.1) AT2G03200 79 / 2e-17 Eukaryotic aspartyl protease family protein (.1) AT5G10770 71 / 1e-14 Eukaryotic aspartyl protease family protein (.1) AT2G36670 68 / 1e-13 Eukaryotic aspartyl protease family protein (.1.2) AT1G79720 65 / 2e-12 Eukaryotic aspartyl protease family protein (.1) AT1G44130 64 / 4e-12 Eukaryotic aspartyl protease family protein (.1) AT3G54400 64 / 4e-12 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G087600 [exp] 328 / 9e-113 AT5G02190 548 / 0.0 PROMOTION OF CELL SURVIVAL 1, EMBRYO DEFECTIVE 24, ARABIDOPSIS THALIANA ASPARTIC PROTEASE 38, Eukaryotic aspartyl protease family protein (.1) Potri.008G058000 [exp] 223 / 8e-72 AT2G39710 607 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.010G201400 [exp] 207 / 1e-65 AT2G39710 583 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.017G131800 [exp] 110 / 1e-28 AT1G66180 570 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.004G085000 [exp] 109 / 2e-28 AT1G66180 605 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.001G041700 [exp] 72 / 7e-15 AT1G79720 521 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.001G306200 [exp] 71 / 2e-14 AT2G03200 501 / 1e-176 Eukaryotic aspartyl protease family protein (.1) Potri.019G002100 [exp] 69 / 6e-14 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.018G014800 [exp] 67 / 4e-13 AT5G10770 312 / 9e-102 Eukaryotic aspartyl protease family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024375 [exp] 279 / 2e-93 AT5G02190 572 / 0.0 PROMOTION OF CELL SURVIVAL 1, EMBRYO DEFECTIVE 24, ARABIDOPSIS THALIANA ASPARTIC PROTEASE 38, Eukaryotic aspartyl protease family protein (.1) Lus10010855 [exp] 254 / 1e-81 AT5G02170 501 / 2e-171 Transmembrane amino acid transporter family protein (.1.2) Lus10040279 [exp] 215 / 3e-69 AT2G39710 566 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10000514 [exp] 214 / 4e-69 AT2G39710 541 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10002707 [exp] 214 / 3e-68 AT2G39710 585 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10004713 [exp] 214 / 6e-68 AT2G39710 567 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10041621 [exp] 77 / 1e-16 AT1G79720 510 / 1e-178 Eukaryotic aspartyl protease family protein (.1) Lus10025702 [exp] 74 / 1e-15 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10035961 [exp] 73 / 3e-15 AT2G03200 525 / 0.0 Eukaryotic aspartyl protease family protein (.1) Lus10003999 [exp] 70 / 3e-14 AT1G01300 636 / 0.0 Eukaryotic aspartyl protease family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0129 [poplar] [flax] Peptidase_AA PF14543 [poplar] [flax] TAXi_N Xylanase inhibitor N-terminal
Representative CDS sequence Show only first row Show all	>Potri.006G087550.1 pacid=42769181 polypeptide=Potri.006G087550.1.p locus=Potri.006G087550 ID=Potri.006G087550.1.v4.1 annot-version=v4.1 ATGGTTATTGACACCGGAAGTGAACTCTCCTGGCTTCACTGCAACAAAACACTATCCTACCCAACTACATTCGACCCGACCGGATCCACATCTTACCAAA CCATCCCTTGTTCTTCACCCATCTGCACCAACCGGACCCAGGACTTCCCTATACCTGCTTCATGTGACTCCAACAACCTCTGCCACGCCACCCTTTCTTA TGCTGACGCTTCTTCCTCCGATGGAAATCTCGCGTCCGATGTTTTCCACATTGGGAGCTCCGATATTTCCGGTTTGGACTTTGGGTGCATGGATTCGGTT TTCAGTTCTAACTCTGATGAGGATTCTAAAAATACCTGTTTAATGGGCATGAATCGTGGGTCGCTCTCTTTTGTTTCCCAATTGGGTTTCCCGAAATTCT CTTATTGCATTTCAGGAACCGATTTTTCGGGTCTTTTACTTCTCGGCGAGTCCAATTTGACGTGGTCGGTGCCATTAAACTACACCCCCTTAATCCAAAT ATCAACCCATTGCCTTACTTTGATCGGGTTGCCTACACGGTACAGCTTGAAGGCATAA
AA sequence Show only first row Show all	>Potri.006G087550.1 pacid=42769181 polypeptide=Potri.006G087550.1.p locus=Potri.006G087550 ID=Potri.006G087550.1.v4.1 annot-version=v4.1 MVIDTGSELSWLHCNKTLSYPTTFDPTGSTSYQTIPCSSPICTNRTQDFPIPASCDSNNLCHATLSYADASSSDGNLASDVFHIGSSDISGLDFGCMDSV FSSNSDEDSKNTCLMGMNRGSLSFVSQLGFPKFSYCISGTDFSGLLLLGESNLTWSVPLNYTPLIQISTHCLTLIGLPTRYSLKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G02190		EMB24, ATASP38,...	PROMOTION OF CELL SURVIVAL 1, ...		Potri.006G087550 [exp]	0	1
					Potri.001G276904 [exp]	1.00	0.8983
AT4G32870			Polyketide cyclase/dehydrase a...		Potri.006G237050 [exp]	5.29	0.8348
					Potri.010G019550 [exp]	6.00	0.8167
AT1G22110			structural constituent of ribo...		Potri.002G092000 [exp]	27.49	0.7444
					Potri.016G080101 [exp]	30.00	0.7539
AT2G27940			RING/U-box superfamily protein...		Potri.001G212101 [exp]	30.39	0.7942
					Potri.006G242350 [exp]	30.49	0.7474
					Potri.002G220667 [exp]	34.19	0.7876
					Potri.003G014056 [exp]	37.81	0.7552
					Potri.001G172450 [exp]	42.96	0.7331

Compare expression of checked genes

Potri.006G087550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.