Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09640 171 / 7e-55 APX1B, APX2 ASCORBATE PEROXIDASE 1B, ascorbate peroxidase 2 (.1.2) AT1G07890 162 / 3e-51 ATAPX01, CS1, APX1, MEE6, ATAPX1 maternal effect embryo arrest 6, ascorbate peroxidase 1 (.1.2.3.4.5.6.7.8) AT4G35000 121 / 5e-35 APX3 ascorbate peroxidase 3 (.1) AT4G35970 113 / 8e-32 APX5 ascorbate peroxidase 5 (.1) AT1G77490 79 / 3e-18 TAPX thylakoidal ascorbate peroxidase (.1) AT4G08390 73 / 3e-16 SAPX stromal ascorbate peroxidase (.1.2.3.4) AT4G09010 50 / 5e-08 TL29, APX4 thylakoid lumen 29, ascorbate peroxidase 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G015400 [exp] 191 / 1e-62 AT1G07890 370 / 4e-131 maternal effect embryo arrest 6, ascorbate peroxidase 1 (.1.2.3.4.5.6.7.8) Potri.006G132200 [exp] 177 / 3e-57 AT3G09640 442 / 2e-159 ASCORBATE PEROXIDASE 1B, ascorbate peroxidase 2 (.1.2) Potri.016G084800 [exp] 175 / 3e-56 AT3G09640 410 / 8e-147 ASCORBATE PEROXIDASE 1B, ascorbate peroxidase 2 (.1.2) Potri.005G112200 [exp] 127 / 5e-37 AT4G35000 438 / 1e-156 ascorbate peroxidase 3 (.1) Potri.004G174500 [exp] 116 / 7e-33 AT4G35000 423 / 6e-151 ascorbate peroxidase 3 (.1) Potri.009G134100 [exp] 112 / 3e-31 AT4G35000 454 / 8e-163 ascorbate peroxidase 3 (.1) Potri.005G179200 [exp] 74 / 3e-16 AT1G77490 556 / 0.0 thylakoidal ascorbate peroxidase (.1) Potri.002G081900 [exp] 73 / 3e-16 AT1G77490 514 / 0.0 thylakoidal ascorbate peroxidase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013537 [exp] 184 / 7e-60 AT1G07890 445 / 1e-160 maternal effect embryo arrest 6, ascorbate peroxidase 1 (.1.2.3.4.5.6.7.8) Lus10015970 [exp] 184 / 4e-59 AT1G07890 436 / 3e-156 maternal effect embryo arrest 6, ascorbate peroxidase 1 (.1.2.3.4.5.6.7.8) Lus10019906 [exp] 165 / 2e-52 AT3G09640 424 / 2e-152 ASCORBATE PEROXIDASE 1B, ascorbate peroxidase 2 (.1.2) Lus10014128 [exp] 121 / 7e-35 AT4G35000 441 / 1e-157 ascorbate peroxidase 3 (.1) Lus10019781 [exp] 121 / 3e-34 AT4G35000 433 / 8e-154 ascorbate peroxidase 3 (.1) Lus10000180 [exp] 98 / 1e-25 AT4G35000 372 / 3e-130 ascorbate peroxidase 3 (.1) Lus10028432 [exp] 76 / 3e-17 AT4G35000 337 / 6e-117 ascorbate peroxidase 3 (.1) Lus10018155 [exp] 76 / 4e-17 AT1G77490 560 / 0.0 thylakoidal ascorbate peroxidase (.1) Lus10025680 [exp] 75 / 7e-17 AT1G77490 584 / 0.0 thylakoidal ascorbate peroxidase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [poplar] [flax] Peroxidase PF00141 [poplar] [flax] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Potri.006G089000.2 pacid=42768291 polypeptide=Potri.006G089000.2.p locus=Potri.006G089000 ID=Potri.006G089000.2.v4.1 annot-version=v4.1 ATGAGAAAAGATTACAGCAAAGCCGTTGAGAAGGCCAAGAAGAAGCTGAGAAGCTTGATTGCTAAGATGAACTGCGCTCATCTCAGTCTTTGTCTAGCAT GGTACTCAGCTGGAACCTTCGGTGTTAAGACAAAAACCGATGGGCCCTTTGGTACCATGAGGTACTCGGCAGAGCTGGCACATGGCGCTAACAATGGTCT CGACATTGCTGTCAGACTCCTTGAGCCCATCAAGGAGCAGTTTCCCATCCTCTCCTATGCTGATTTCTACCAACTAGCTGGTGTTGTTAGCGTTGCAATC ACTGGTGGTCCTGAGGTTCCTTTCCACCCTAGGAGTGAGCCCAGCATAGTACTGTAA
AA sequence Show only first row Show all	>Potri.006G089000.2 pacid=42768291 polypeptide=Potri.006G089000.2.p locus=Potri.006G089000 ID=Potri.006G089000.2.v4.1 annot-version=v4.1 MRKDYSKAVEKAKKKLRSLIAKMNCAHLSLCLAWYSAGTFGVKTKTDGPFGTMRYSAELAHGANNGLDIAVRLLEPIKEQFPILSYADFYQLAGVVSVAI TGGPEVPFHPRSEPSIVL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09640		APX1B, APX2	ASCORBATE PEROXIDASE 1B, ascor...		Potri.006G089000 [exp]	0	1
AT5G32450			RNA binding (RRM/RBD/RNP motif...		Potri.019G037600 [exp]	16.79	0.8236
AT2G25220			Protein kinase superfamily pro...		Potri.018G022300 [exp]	19.64	0.8129
AT1G53840		ATPME1	pectin methylesterase 1 (.1)		Potri.001G162700 [exp]	22.00	0.7681
AT5G28150			Plant protein of unknown funct...		Potri.005G210800 [exp]	66.48	0.7691
AT3G61540			alpha/beta-Hydrolases superfam...		Potri.002G164700 [exp]	99.72	0.7576
AT2G36530		ENO2, LOS2	LOW EXPRESSION OF OSMOTICALLY ...		Potri.012G129300 [exp]	130.24	0.7458
AT5G47780		GAUT4	galacturonosyltransferase 4 (....		Potri.016G001700 [exp]	194.85	0.7219
AT4G27660			unknown protein		Potri.015G003200 [exp]	195.26	0.7130
AT5G56750		NDL1	N-MYC downregulated-like 1 (.1...		Potri.013G038100 [exp]	214.77	0.7161
AT2G16250			Leucine-rich repeat protein ki...		Potri.014G196600 [exp]	217.22	0.7176

Compare expression of checked genes

Potri.006G089000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.