Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53820 95 / 2e-25 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G09290 76 / 2e-17 C2H2ZnF TAC1 telomerase activator1 (.1) AT2G37740 73 / 6e-16 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) AT3G23130 70 / 4e-15 C2H2ZnF FLO10, FON1, SUP SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G43540 66 / 2e-14 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G06070 67 / 9e-14 C2H2ZnF RAB, RBE RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) AT2G42410 65 / 4e-13 C2H2ZnF ATZFP11, ZFP11 zinc finger protein 11 (.1) AT4G17810 61 / 9e-12 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G23140 54 / 2e-09 C2H2ZnF URO UPRIGHT ROSETTE, C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G27880 50 / 8e-08 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G101300 [exp] 248 / 1e-85 AT3G53820 92 / 2e-24 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.009G037100 [exp] 97 / 9e-26 AT3G53820 74 / 5e-17 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.002G041600 [exp] 74 / 1e-16 AT4G17810 65 / 6e-13 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.005G221500 [exp] 73 / 1e-16 AT5G43540 61 / 6e-12 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.002G041700 [exp] 71 / 2e-15 AT2G42410 105 / 3e-28 zinc finger protein 11 (.1) Potri.008G164100 [exp] 69 / 5e-15 AT5G43540 69 / 3e-15 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.010G074400 [exp] 69 / 1e-14 AT5G43540 69 / 3e-15 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.008G059000 [exp] 68 / 6e-14 AT5G06070 99 / 2e-24 RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.005G221400 [exp] 66 / 8e-14 AT2G42410 97 / 4e-25 zinc finger protein 11 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024363 [exp] 81 / 1e-19 AT3G53820 69 / 3e-15 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10010870 [exp] 79 / 1e-18 AT3G09290 65 / 2e-13 telomerase activator1 (.1) Lus10040767 [exp] 71 / 2e-15 AT3G09290 71 / 5e-15 telomerase activator1 (.1) Lus10021213 [exp] 69 / 7e-15 AT3G09290 73 / 2e-16 telomerase activator1 (.1) Lus10022204 [exp] 67 / 8e-15 AT3G09290 67 / 2e-15 telomerase activator1 (.1) Lus10022206 [exp] 68 / 3e-14 AT3G23130 100 / 1e-25 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10021215 [exp] 69 / 6e-14 AT3G23130 102 / 1e-25 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10024362 [exp] 67 / 8e-14 AT2G37740 105 / 4e-27 zinc-finger protein 10 (.1) Lus10021490 [exp] 67 / 1e-13 AT2G37740 103 / 1e-25 zinc-finger protein 10 (.1) Lus10010871 [exp] 67 / 1e-13 AT2G37740 103 / 9e-26 zinc-finger protein 10 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G089301.1 pacid=42767836 polypeptide=Potri.006G089301.1.p locus=Potri.006G089301 ID=Potri.006G089301.1.v4.1 annot-version=v4.1 ATGGATATTAGTCCCACAAGCAGTACAGGAAAGTCCGACCAAATAGTATGCGATTCAGATTATCTGCAGGACTCAAGCCATGTAAGGTCTTATACTTGTG CTTTCTGCAAGAGAGGCTTCTCAAATGCACAAGCATTGGGAGGCCACATGAATATCCATAGAAGAGATAGGGCAAAACTTAAACAAGCTTCCGACGAAAA CTTTCTTTCTTTGGACATCACAAAGTCCACTGAGGAAATAAGTAGAGCGCCTAAAACGCCATGTGCTCTGCCAGTTGATCAACATGTTAGTTTTACTCTT AGAAATAAAGCTAGCGAAGAAGTTCAGCCGCTACCCTTTATTGTTGATGTGAAGGCAGGTACTGATGGCGATGAAGATAACAAGATGCAATTGAATCAAG CTACGATGCAGGCGGGATTGGACCTGGAGCTTCGATTAGGGTCCGATCCACACGAATCATCTACAAGGTCGAGTCCCAGAGAATTCCTTTGA
AA sequence Show only first row Show all	>Potri.006G089301.1 pacid=42767836 polypeptide=Potri.006G089301.1.p locus=Potri.006G089301 ID=Potri.006G089301.1.v4.1 annot-version=v4.1 MDISPTSSTGKSDQIVCDSDYLQDSSHVRSYTCAFCKRGFSNAQALGGHMNIHRRDRAKLKQASDENFLSLDITKSTEEISRAPKTPCALPVDQHVSFTL RNKASEEVQPLPFIVDVKAGTDGDEDNKMQLNQATMQAGLDLELRLGSDPHESSTRSSPREFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G53820	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Potri.006G089301 [exp]	0	1
AT3G23280		XBAT35	XB3 ortholog 5 in Arabidopsis ...		Potri.010G070800 [exp]	2.44	0.8104
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Potri.006G219300 [exp]	2.44	0.8216
AT2G14110			Haloacid dehalogenase-like hyd...		Potri.017G043900 [exp]	3.16	0.8153
AT3G05640			Protein phosphatase 2C family ...		Potri.010G006100 [exp]	5.91	0.7985
AT1G32170		XTH30, XTR4	xyloglucan endotransglycosylas...		Potri.001G136100 [exp]	9.00	0.7927	XTR4.2
AT4G23740			Leucine-rich repeat protein ki...		Potri.012G033200 [exp]	9.53	0.7267
AT3G02875		ILR1	IAA-LEUCINE RESISTANT 1, Pepti...		Potri.016G074100 [exp]	9.64	0.7498
AT1G15890			Disease resistance protein (CC...		Potri.001G172300 [exp]	11.61	0.7719
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Potri.017G087800 [exp]	15.16	0.7417
AT3G14470			NB-ARC domain-containing disea...		Potri.003G025904 [exp]	16.61	0.8162

Compare expression of checked genes

Potri.006G089301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.