Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53830 129 / 1e-36 Regulator of chromosome condensation (RCC1) family protein (.1) AT3G55580 127 / 4e-36 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G63860 71 / 1e-15 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT1G27060 57 / 6e-11 Regulator of chromosome condensation (RCC1) family protein (.1) AT3G26100 54 / 2e-09 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT5G60870 52 / 4e-09 RUG3 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) AT4G14368 52 / 5e-09 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G42140 52 / 9e-09 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT3G02300 51 / 1e-08 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G19420 51 / 2e-08 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G101700 [exp] 160 / 2e-48 AT3G53830 547 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.010G199100 [exp] 140 / 9e-41 AT3G55580 564 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.008G059800 [exp] 138 / 3e-40 AT3G55580 566 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.007G100200 [exp] 71 / 1e-15 AT5G63860 738 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.T124906 [exp] 58 / 6e-11 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.003G197600 [exp] 58 / 6e-11 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.015G107000 [exp] 57 / 6e-11 AT1G27060 446 / 1e-156 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.001G026900 [exp] 55 / 6e-10 AT5G19420 1281 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.008G167500 [exp] 55 / 7e-10 AT4G14368 1266 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040266 [exp] 129 / 8e-37 AT3G55580 588 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10004700 [exp] 129 / 1e-36 AT3G55580 603 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10029536 [exp] 70 / 4e-15 AT5G63860 642 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10039618 [exp] 69 / 6e-15 AT5G63860 715 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10013197 [exp] 59 / 3e-11 AT3G02300 711 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10030712 [exp] 55 / 6e-10 AT3G02300 717 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10006242 [exp] 54 / 1e-09 AT3G26100 796 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10036945 [exp] 54 / 1e-09 AT3G26100 565 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10035957 [exp] 54 / 2e-09 AT5G08710 504 / 1e-178 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10042800 [exp] 53 / 3e-09 AT5G42140 1461 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF13540 [poplar] [flax] RCC1_2 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Potri.006G089901.1 pacid=42767053 polypeptide=Potri.006G089901.1.p locus=Potri.006G089901 ID=Potri.006G089901.1.v4.1 annot-version=v4.1 ATGGCCGGCCACAAAACAATTCAATTTCTCCATTTTTGTGGGAATCAGTTTGCACAACTGGGAACTGGATCTGACCAGGGTGAGAGTATACCAAGACTTT TGGATGCTCCATGTCTGGAGAGTAAGCAGGCGAAGATGGTTTCATGTGGAGCTCGACACAGTGCTATTCTAACAGAGGATGGCCAAGTATTTTCCTGGGG ATGGAACAAGCATGGCCAGCTTGGCGTGGGTGATTCAATGGATCGTTGTCGACCAAAAAGTGTTGCATGTGGCTGGTGGCTCACATTATTGCTAGCTGAA ACACCCCTGAGATCCTAG
AA sequence Show only first row Show all	>Potri.006G089901.1 pacid=42767053 polypeptide=Potri.006G089901.1.p locus=Potri.006G089901 ID=Potri.006G089901.1.v4.1 annot-version=v4.1 MAGHKTIQFLHFCGNQFAQLGTGSDQGESIPRLLDAPCLESKQAKMVSCGARHSAILTEDGQVFSWGWNKHGQLGVGDSMDRCRPKSVACGWWLTLLLAE TPLRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G53830			Regulator of chromosome conden...		Potri.006G089901 [exp]	0	1
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Potri.005G185000 [exp]	2.44	0.9845
					Potri.014G063350 [exp]	2.82	0.9699
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Potri.016G118500 [exp]	3.00	0.9815
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Potri.006G247800 [exp]	3.16	0.9536
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Potri.009G098400 [exp]	6.48	0.9523
					Potri.014G061600 [exp]	8.12	0.9202
					Potri.008G057666 [exp]	12.40	0.9458
AT3G12320			unknown protein		Potri.003G193800 [exp]	12.96	0.8779
					Potri.002G021200 [exp]	13.07	0.9518
					Potri.014G065200 [exp]	13.78	0.9505

Compare expression of checked genes

Potri.006G089901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.