Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37770 113 / 3e-32 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT3G53880 104 / 8e-29 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37790 101 / 1e-27 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 92 / 3e-24 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT5G01670 63 / 2e-13 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT5G62420 60 / 4e-12 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 56 / 7e-11 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 53 / 1e-09 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59950 47 / 1e-07 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59960 46 / 3e-07 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G102100 [exp] 125 / 1e-36 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102032 [exp] 125 / 1e-36 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.006G090600 [exp] 109 / 1e-30 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.017G070600 [exp] 105 / 5e-29 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102300 [exp] 86 / 9e-22 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.001G125400 [exp] 62 / 4e-13 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.009G125100 [exp] 59 / 1e-11 AT2G21250 526 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.005G097000 [exp] 58 / 2e-11 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G193100 [exp] 57 / 4e-11 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024354 [exp] 110 / 7e-30 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010884 [exp] 105 / 3e-29 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10012652 [exp] 106 / 6e-29 AT2G37770 441 / 4e-155 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010885 [exp] 105 / 8e-29 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024353 [exp] 104 / 1e-28 AT2G37770 491 / 1e-176 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10021491 [exp] 96 / 2e-25 AT2G37770 464 / 2e-166 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024350 [exp] 89 / 4e-22 AT3G53900 374 / 9e-128 PYRIMIDINE R, uracil phosphoribosyltransferase (.1.2) Lus10027216 [exp] 70 / 1e-15 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10031162 [exp] 62 / 7e-13 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10029208 [exp] 61 / 2e-12 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [poplar] [flax] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Potri.006G090501.1 pacid=42770210 polypeptide=Potri.006G090501.1.p locus=Potri.006G090501 ID=Potri.006G090501.1.v4.1 annot-version=v4.1 ATGATTCCGGCAAGGCTCGTGCTATTGGAGTTGGGGTATACACCTCTAGGTTCCCCAGGTCCGGGAACCATCAAGACTCAGGCTCTCAAGAATTCAATTC TTAATATGATTGCGGAGAAATTAGGAAAATCTCCAGCACAGGTAGCTCTTAGGTGGGGACTCCAAATGGGCCACAGTGTGTTGCCTAAGAGCACAAATGA GGCAAGGATTAAGGAAAACTTCGACATTTTTGGATTGGTCTCTTCCTGA
AA sequence Show only first row Show all	>Potri.006G090501.1 pacid=42770210 polypeptide=Potri.006G090501.1.p locus=Potri.006G090501 ID=Potri.006G090501.1.v4.1 annot-version=v4.1 MIPARLVLLELGYTPLGSPGPGTIKTQALKNSILNMIAEKLGKSPAQVALRWGLQMGHSVLPKSTNEARIKENFDIFGLVSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Potri.006G090501 [exp]	0	1
AT3G20530			Protein kinase superfamily pro...		Potri.001G421400 [exp]	3.00	0.7099
AT5G05800			unknown protein		Potri.008G189300 [exp]	6.92	0.6043
AT4G00910			Aluminium activated malate tra...		Potri.014G101200 [exp]	8.06	0.5879
AT1G57775			Protein of unknown function (D...		Potri.004G109666 [exp]	10.24	0.5791
AT1G69940		ATPPME1	Pectin lyase-like superfamily ...		Potri.006G137100 [exp]	11.66	0.6851
AT1G57775			Protein of unknown function (D...		Potri.004G109500 [exp]	12.00	0.5525
AT1G54850			HSP20-like chaperones superfam...		Potri.013G024750 [exp]	12.96	0.5904
AT1G73930			unknown protein		Potri.001G289250 [exp]	20.49	0.5493
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G117034 [exp]	21.44	0.5493
AT5G57810		TET15	tetraspanin15 (.1)		Potri.018G100000 [exp]	21.90	0.5493

Compare expression of checked genes

Potri.006G090501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.