Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-SDH4.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02050 228 / 9e-75 Mitochondrial glycoprotein family protein (.1) AT3G55605 185 / 3e-58 Mitochondrial glycoprotein family protein (.1) AT2G39795 180 / 2e-56 Mitochondrial glycoprotein family protein (.1) AT5G05990 169 / 5e-52 Mitochondrial glycoprotein family protein (.1) AT2G39790 112 / 3e-30 Mitochondrial glycoprotein family protein (.1) AT1G80720 111 / 4e-30 Mitochondrial glycoprotein family protein (.1) AT1G15870 112 / 5e-30 Mitochondrial glycoprotein family protein (.1) AT4G31930 89 / 4e-21 Mitochondrial glycoprotein family protein (.1) AT4G32605 60 / 1e-10 Mitochondrial glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G102200 [exp] 377 / 9e-134 AT5G02050 216 / 4e-70 Mitochondrial glycoprotein family protein (.1) Potri.004G049600 [exp] 268 / 2e-90 AT5G02050 96 / 4e-23 Mitochondrial glycoprotein family protein (.1) Potri.010G198600 [exp] 219 / 2e-71 AT2G39795 222 / 1e-72 Mitochondrial glycoprotein family protein (.1) Potri.010G198500 [exp] 199 / 1e-63 AT3G55605 210 / 1e-67 Mitochondrial glycoprotein family protein (.1) Potri.001G047600 [exp] 105 / 2e-27 AT1G15870 256 / 2e-86 Mitochondrial glycoprotein family protein (.1) Potri.018G021600 [exp] 103 / 7e-27 AT4G31930 259 / 1e-87 Mitochondrial glycoprotein family protein (.1) Potri.010G244500 [exp] 67 / 4e-13 AT4G32605 242 / 3e-81 Mitochondrial glycoprotein family protein (.1) Potri.008G015600 [exp] 64 / 5e-12 AT4G32605 262 / 2e-88 Mitochondrial glycoprotein family protein (.1) Potri.006G046350 [exp] 45 / 1e-05 AT2G41600 210 / 2e-69 Mitochondrial glycoprotein family protein (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024351 [exp] 280 / 1e-95 AT5G02050 231 / 6e-76 Mitochondrial glycoprotein family protein (.1) Lus10001015 [exp] 234 / 2e-77 AT3G55605 232 / 1e-76 Mitochondrial glycoprotein family protein (.1) Lus10030157 [exp] 231 / 5e-76 AT3G55605 236 / 6e-78 Mitochondrial glycoprotein family protein (.1) Lus10012653 [exp] 211 / 2e-69 AT5G02050 201 / 2e-65 Mitochondrial glycoprotein family protein (.1) Lus10001017 [exp] 200 / 7e-65 AT3G55605 199 / 2e-64 Mitochondrial glycoprotein family protein (.1) Lus10024352 [exp] 113 / 7e-31 AT5G02050 78 / 3e-17 Mitochondrial glycoprotein family protein (.1) Lus10026060 [exp] 109 / 9e-29 AT1G15870 263 / 4e-89 Mitochondrial glycoprotein family protein (.1) Lus10017126 [exp] 92 / 3e-22 AT4G31930 240 / 3e-80 Mitochondrial glycoprotein family protein (.1) Lus10018327 [exp] 89 / 3e-21 AT4G31930 243 / 2e-81 Mitochondrial glycoprotein family protein (.1) Lus10012652 [exp] 88 / 6e-20 AT2G37770 441 / 4e-155 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02330 [poplar] [flax] MAM33 Mitochondrial glycoprotein
Representative CDS sequence Show only first row Show all	>Potri.006G090700.1 pacid=42769984 polypeptide=Potri.006G090700.1.p locus=Potri.006G090700 ID=Potri.006G090700.1.v4.1 annot-version=v4.1 ATGGCTTTCAACTCAGTTCTTCGCCGAGCCTCCAAATCCTTCTTGCCTCTCGCTATCCGCACCGTCGGGTCTCCCAGAACCTTCCAAAGAGCTATCCCCA CCGTTCTCTTCGTTGAAAACCGCACCACTCTACGAAACTTCCTTCCATTTTCACATTTCTCAACAGCGGCCACTTCAGAGAAACCGATCGCCGATGACAA TTTGATTCGAGCTCTTGAAACAGAGATCGATTGCGCCGAGGAACCCCAAGATGTAGAGGATATCCCAAATGAATTTCCTTTCAAAATTGAAGATAATCCC GGGGAGAGGACCATTTCACTAAATAGAAAGTTCCAAGATGAAACTATCAAAATTGAAGTTGACATGCCTAATGTTTCAATTGATGTTGAGGATACCGATG ACAATACCAAGGACGCAGATGTCTCTAGCATTCCACTGGTTGTGAGTATTTCCAAGGGAAGTGGTCAGCATATGGAGTTTGGTATCACTGCTTTCCCTGA TGAGATCACAATTGATAGCTTGTCAATTAAAAACCCAGAAAATTCGGATGAACTTGCATATGCAGGACCTGATTTTAATGATTTGGATGAGAATTTGCAG AATGCTTTCCACAAGCATCTCGAGATTAGAGGGATCAAACCTAGCACAACAAATGTTTTGTTCGACTACATGGCCAACAAAGACAACAAAGAATACTTGC TATGGCTGAAGAACCTCAAAAATTTTGTGGAGAAGTAA
AA sequence Show only first row Show all	>Potri.006G090700.1 pacid=42769984 polypeptide=Potri.006G090700.1.p locus=Potri.006G090700 ID=Potri.006G090700.1.v4.1 annot-version=v4.1 MAFNSVLRRASKSFLPLAIRTVGSPRTFQRAIPTVLFVENRTTLRNFLPFSHFSTAATSEKPIADDNLIRALETEIDCAEEPQDVEDIPNEFPFKIEDNP GERTISLNRKFQDETIKIEVDMPNVSIDVEDTDDNTKDADVSSIPLVVSISKGSGQHMEFGITAFPDEITIDSLSIKNPENSDELAYAGPDFNDLDENLQ NAFHKHLEIRGIKPSTTNVLFDYMANKDNKEYLLWLKNLKNFVEK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G02050			Mitochondrial glycoprotein fam...		Potri.006G090700 [exp]	0	1	Pt-SDH4.3
AT3G13230			RNA-binding KH domain-containi...		Potri.001G469200 [exp]	1.41	0.8604
AT4G37090			unknown protein		Potri.007G034600 [exp]	3.74	0.8619
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Potri.017G080700 [exp]	4.00	0.8375
AT4G27585			SPFH/Band 7/PHB domain-contain...		Potri.015G001900 [exp]	4.12	0.8179
AT5G61770		PPAN	PETER PAN-like protein (.1.2.3...		Potri.014G129700 [exp]	4.24	0.8517
AT2G20940			Protein of unknown function (D...		Potri.009G136100 [exp]	5.47	0.8416
AT3G13940			DNA binding;DNA-directed RNA p...		Potri.001G198600 [exp]	7.74	0.8324
AT5G14520			pescadillo-related (.1)		Potri.004G121400 [exp]	8.06	0.8461
AT5G24840			tRNA (guanine-N-7) methyltrans...		Potri.018G003900 [exp]	8.36	0.7884
AT5G61770		PPAN	PETER PAN-like protein (.1.2.3...		Potri.002G204900 [exp]	8.71	0.8464

Compare expression of checked genes

Potri.006G090700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.