Potri.006G091500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04590 272 / 3e-90 EMB2748 unknown protein
AT4G21190 134 / 2e-37 EMB1417 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G18975 129 / 3e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G103000 423 / 5e-151 AT1G04590 300 / 9e-101 unknown protein
Potri.016G102800 186 / 3e-60 AT1G04590 158 / 2e-48 unknown protein
Potri.017G148700 132 / 3e-36 AT4G21190 339 / 3e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.011G076800 124 / 8e-34 AT4G18975 320 / 2e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019008 272 / 5e-91 AT1G04590 281 / 5e-93 unknown protein
Lus10015943 266 / 1e-89 AT1G04590 284 / 3e-95 unknown protein
Lus10028526 120 / 2e-32 AT4G18975 327 / 7e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
Lus10027535 112 / 1e-29 AT4G21190 302 / 5e-103 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10039292 107 / 9e-27 AT4G21190 339 / 7e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009120 69 / 3e-13 AT4G18975 198 / 1e-61 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
PFAM info
Representative CDS sequence
>Potri.006G091500.2 pacid=42767213 polypeptide=Potri.006G091500.2.p locus=Potri.006G091500 ID=Potri.006G091500.2.v4.1 annot-version=v4.1
ATGATTGGGCATTTAAGGAGAATAGGAGTGGGCAGGGTGCAAACCTTGCTAAATTCTAGCTACAAAACGACAATGGAAGTTCAAATACTAACATCTAAGA
CACACTCTGCTGCTAATGCTGCTTTGCCTTTGTCACAGGCAGTTTACCATGATGGAAAATCAGAGCAGAATCTGAGGCGAAACCAAATTGGTGACAATGT
CTCCAAGAAGGACAAGATCAAATTTCTCATTACCACACTTTTAGATCTAAATGACAGCAAGGATGCTGTTTATGGTGCTCTTGATGCCTGGGTTGCATGG
GAGCAAAAGTTTCCTATTGCGTCAATTAAGCAAGTATTGATTGCTCTTGAGAAGGAACAACAGTGGCATAGAATTGTTCAGGTTATTAAATGGATGCTAA
GCAAGGGGCAGGGAACCACAATGGCAACTTATGCACAGTTAATACGAGCATTAGATATGGACCACAGAGCAAAAGAAGCACATGAGTTTTGGTTGAAGAA
AATTGGTAGAGATCTTCATTCCGTGCCATGGAAGCTATGTAATAGCATGATATCTATATACTACAGAAACAACATGCTAGAGAATCTTATAAAGCTTTTC
AAGGGGTTGGAAGCTTTTGATCGTAAACCTCCAGAAAAATCAATTGTGCAAAAAGTAGCAGATGCATATGAGATGCTAGGCTTACTTGAAGAAAAGGGAA
GGTTACTAGAGAAGTACAATCATCTCTTCATTGAGACAGGGAAAGGATGGAACAAGAATTTTAGGGTTGTCTCTTCCAAAAAAAATAACAAATCAGGGAA
GGCAAAAAATTGA
AA sequence
>Potri.006G091500.2 pacid=42767213 polypeptide=Potri.006G091500.2.p locus=Potri.006G091500 ID=Potri.006G091500.2.v4.1 annot-version=v4.1
MIGHLRRIGVGRVQTLLNSSYKTTMEVQILTSKTHSAANAALPLSQAVYHDGKSEQNLRRNQIGDNVSKKDKIKFLITTLLDLNDSKDAVYGALDAWVAW
EQKFPIASIKQVLIALEKEQQWHRIVQVIKWMLSKGQGTTMATYAQLIRALDMDHRAKEAHEFWLKKIGRDLHSVPWKLCNSMISIYYRNNMLENLIKLF
KGLEAFDRKPPEKSIVQKVADAYEMLGLLEEKGRLLEKYNHLFIETGKGWNKNFRVVSSKKNNKSGKAKN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G04590 EMB2748 unknown protein Potri.006G091500 0 1
AT1G08620 PKDM7D Transcription factor jumonji (... Potri.002G037300 7.61 0.8959
AT1G13270 MAP1B, MAP1C methionine aminopeptidase 1B (... Potri.010G129101 24.57 0.9152
AT1G66200 ATGSR2, GLN1;2 glutamine synthetase 1;2, glut... Potri.017G138201 29.94 0.9192
AT5G06060 NAD(P)-binding Rossmann-fold s... Potri.010G199700 47.13 0.8682
AT1G78940 Protein kinase protein with ad... Potri.014G001700 70.99 0.9036
AT1G45616 AtRLP6 receptor like protein 6 (.1) Potri.012G024900 76.86 0.8672
AT1G49180 protein kinase family protein ... Potri.019G011600 79.39 0.8687
AT3G17790 ATACP5, ATPAP17... purple acid phosphatase 17 (.1... Potri.010G101900 96.75 0.8991
AT5G36930 Disease resistance protein (TI... Potri.007G142600 104.49 0.8987
AT3G60300 RWD domain-containing protein ... Potri.014G048000 121.54 0.8902

Potri.006G091500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.