Potri.006G098900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38152 258 / 1e-85 alpha 1,4-glycosyltransferase family protein (.1)
AT3G09020 254 / 6e-84 alpha 1,4-glycosyltransferase family protein (.1)
AT5G01250 251 / 7e-83 alpha 1,4-glycosyltransferase family protein (.1)
AT2G38150 243 / 2e-79 alpha 1,4-glycosyltransferase family protein (.1)
AT1G61050 231 / 2e-74 alpha 1,4-glycosyltransferase family protein (.1)
AT4G19900 87 / 7e-20 alpha 1,4-glycosyltransferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G114200 387 / 9e-136 AT3G09020 419 / 3e-145 alpha 1,4-glycosyltransferase family protein (.1)
Potri.011G047700 265 / 2e-87 AT1G61050 389 / 1e-132 alpha 1,4-glycosyltransferase family protein (.1)
Potri.004G039300 265 / 2e-87 AT1G61050 393 / 4e-134 alpha 1,4-glycosyltransferase family protein (.1)
Potri.015G122200 73 / 7e-15 AT4G19900 420 / 7e-138 alpha 1,4-glycosyltransferase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035526 284 / 2e-95 AT5G01250 362 / 6e-123 alpha 1,4-glycosyltransferase family protein (.1)
Lus10027770 276 / 3e-92 AT5G01250 366 / 2e-124 alpha 1,4-glycosyltransferase family protein (.1)
Lus10011206 251 / 1e-81 AT1G61050 345 / 5e-115 alpha 1,4-glycosyltransferase family protein (.1)
Lus10004828 248 / 3e-81 AT2G38150 430 / 2e-149 alpha 1,4-glycosyltransferase family protein (.1)
Lus10027772 241 / 1e-78 AT2G38150 409 / 2e-141 alpha 1,4-glycosyltransferase family protein (.1)
Lus10035525 241 / 2e-78 AT2G38150 409 / 2e-141 alpha 1,4-glycosyltransferase family protein (.1)
Lus10027771 244 / 2e-74 AT2G38150 317 / 8e-97 alpha 1,4-glycosyltransferase family protein (.1)
Lus10002496 201 / 3e-63 AT2G38150 388 / 4e-133 alpha 1,4-glycosyltransferase family protein (.1)
Lus10018315 88 / 4e-20 AT4G19900 699 / 0.0 alpha 1,4-glycosyltransferase family protein (.1)
Lus10017137 87 / 1e-19 AT4G19900 693 / 0.0 alpha 1,4-glycosyltransferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0110 GT-A PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif
CL0110 PF04572 Gb3_synth Alpha 1,4-glycosyltransferase conserved region
Representative CDS sequence
>Potri.006G098900.2 pacid=42767531 polypeptide=Potri.006G098900.2.p locus=Potri.006G098900 ID=Potri.006G098900.2.v4.1 annot-version=v4.1
ATGTTCAAGAAAACTCCAGCAGAAACTTGGTTTGAAGAGATGAAGAGTGGGAACAAAGACCCTGGCGAAATTCCATTGTCTCAGAATCTATCAAACCTCA
TTATACTTGCAGTTTTAAACAAGTATGGAGGGATTTACCTGGATACAGATTTCATTGTCCTAAAAAGTTTTGCAGGCTTGAGGAACGCAATTGGAGCACA
AAGTATTGGTGTGTCCAAGAATTGGACAAGATTGAACAATGCAGTTCTAGTCTTTGATATGAATCATCCACTACTTTTCAAGTTCATAGAAGAATTCGCT
TCGACTTTCGATGGAAATAAATGGGGGCATAATGGACCCTATTTGGTCTCCAGAGTTGTGCAGAAAGTGGCTGAGAGACCTGGATATAACTTTACAATCT
TGCCTCCCATGGCATTCTATCCAGTTGGTTGGAATAGGATAGGTGGTTTTTTCAAGAAATCAGAAAGCAATGCGGAATCAAGATGGGTAAATGCCAAGCT
ACTTCAGCTTATAAGTGGGGAGACTTATGGGATACACGTATGGAACAGGCAGAGCAGTAGATTCAGCATTGAAGAGGGAAGTATCATGGGTAGATTGATC
TCAGATAATTGTGTCATTTGGGAATACAAATAA
AA sequence
>Potri.006G098900.2 pacid=42767531 polypeptide=Potri.006G098900.2.p locus=Potri.006G098900 ID=Potri.006G098900.2.v4.1 annot-version=v4.1
MFKKTPAETWFEEMKSGNKDPGEIPLSQNLSNLIILAVLNKYGGIYLDTDFIVLKSFAGLRNAIGAQSIGVSKNWTRLNNAVLVFDMNHPLLFKFIEEFA
STFDGNKWGHNGPYLVSRVVQKVAERPGYNFTILPPMAFYPVGWNRIGGFFKKSESNAESRWVNAKLLQLISGETYGIHVWNRQSSRFSIEEGSIMGRLI
SDNCVIWEYK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G38152 alpha 1,4-glycosyltransferase ... Potri.006G098900 0 1
AT3G24060 Plant self-incompatibility pro... Potri.003G175000 6.92 0.8379
AT3G04830 Protein prenylyltransferase su... Potri.013G038501 14.07 0.8541
Potri.002G048450 27.42 0.8262
AT3G20820 Leucine-rich repeat (LRR) fami... Potri.001G269800 28.86 0.8432
Potri.011G073216 33.31 0.8368
AT1G15950 IRX4, ATCCR1, C... IRREGULAR XYLEM 4, cinnamoyl c... Potri.001G045100 37.14 0.8170
AT5G66330 Leucine-rich repeat (LRR) fami... Potri.007G016800 39.11 0.8258
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Potri.009G123600 41.23 0.7797 /F5H2,Pt-IFS1.57
AT5G53400 BOB1, BOBBER1 BOBBER1, HSP20-like chaperones... Potri.003G100900 41.36 0.7915
AT4G19610 nucleotide binding;nucleic aci... Potri.001G081000 41.68 0.8320

Potri.006G098900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.