Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08920 238 / 8e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G24750 113 / 3e-30 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G42220 104 / 2e-27 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT4G27700 75 / 3e-16 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G21045 49 / 3e-07 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT5G66040 45 / 5e-06 STR16 sulfurtransferase protein 16 (.1.2) AT2G17850 43 / 4e-05 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT5G66170 39 / 0.0008 STR18 sulfurtransferase 18 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G086100 [exp] 110 / 5e-29 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.006G059200 [exp] 107 / 2e-28 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.012G020700 [exp] 68 / 1e-13 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.015G008000 [exp] 64 / 4e-12 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.005G111200 [exp] 50 / 8e-08 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.014G131300 [exp] 48 / 4e-07 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.002G014900 [exp] 48 / 9e-07 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.005G106400 [exp] 48 / 1e-06 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004811 [exp] 317 / 4e-111 AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Lus10002485 [exp] 317 / 5e-111 AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Lus10019454 [exp] 104 / 7e-27 AT4G24750 390 / 2e-137 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Lus10043306 [exp] 103 / 2e-26 AT4G24750 389 / 3e-137 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Lus10021032 [exp] 97 / 3e-24 AT2G42220 304 / 2e-105 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Lus10023820 [exp] 95 / 1e-23 AT2G42220 302 / 1e-104 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Lus10023243 [exp] 62 / 2e-11 AT4G27700 305 / 7e-106 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Lus10012566 [exp] 56 / 5e-10 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2) Lus10008866 [exp] 54 / 2e-08 AT4G27700 249 / 4e-84 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Lus10041843 [exp] 50 / 2e-07 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [poplar] [flax] Phosphatase PF00581 [poplar] [flax] Rhodanese Rhodanese-like domain
Representative CDS sequence Show only first row Show all	>Potri.006G100600.1 pacid=42770201 polypeptide=Potri.006G100600.1.p locus=Potri.006G100600 ID=Potri.006G100600.1.v4.1 annot-version=v4.1 ATGGCACTTCAACTGAACCACTTCTATCCATACACTTCTAAGCATGGCAAACAACCTAAGCCTGCACTTACCTCCACCAGACCTAGGCCAACAAAATTTC AAGTCAAAGCAGCGTCCACAAATGGCAGGGAGCTGATACAGTCTGGTGCTGTCAGGCCAATACCACCAAAGGAGGCAGCCATGGCAATGAGCTCTGAAGG TTTCGTACTCCTGGACATCAGACCAGATTGGGAGAGGGACAAGGCACGGGTGGCTGGGTCATTGCACGTGCCACTCTTTGTCAAAGACATGGACAATAGT CCCTTGACTCTTTTGAAGAAGTGGGTTCATTTTGGATACATTGGCTTATGGACTGGCCAAAATTTCACCACGATGAATCCTGATTTTCTCCAGCAAGTGG AGGCCGAAGTTCCTGACAAGGATGCCAAGCTTCTTGTGGCTTGTGGTGAAGGACTAAGGTCCGTTATGGCAGCTTCGAAGTTGTACGCGGGAGGATTCAA GAACTTGGGATGGCTTGCTGGAGGATTCAATCGTTCTGCAGTTAGTGATTTCCCAGCTGTTGAAGGTTCAGAAAAATTGCAATATGCGACCATAGGTGGT GTTTCCTACTTCTTCCTTCAATTACTCATACTGTTGCAAGCCGTGGGCAAGGATGATTGA
AA sequence Show only first row Show all	>Potri.006G100600.1 pacid=42770201 polypeptide=Potri.006G100600.1.p locus=Potri.006G100600 ID=Potri.006G100600.1.v4.1 annot-version=v4.1 MALQLNHFYPYTSKHGKQPKPALTSTRPRPTKFQVKAASTNGRELIQSGAVRPIPPKEAAMAMSSEGFVLLDIRPDWERDKARVAGSLHVPLFVKDMDNS PLTLLKKWVHFGYIGLWTGQNFTTMNPDFLQQVEAEVPDKDAKLLVACGEGLRSVMAASKLYAGGFKNLGWLAGGFNRSAVSDFPAVEGSEKLQYATIGG VSYFFLQLLILLQAVGKDD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G08920			Rhodanese/Cell cycle control p...		Potri.006G100600 [exp]	0	1
AT1G77490		TAPX	thylakoidal ascorbate peroxida...		Potri.005G179200 [exp]	240.62	0.5846

Compare expression of checked genes

Potri.006G100600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.