Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01350 95 / 1e-27 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G118800 [exp] 137 / 2e-44 AT5G01350 85 / 1e-23 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005043 [exp] 99 / 2e-27 AT2G38280 249 / 1e-77 EMBRYONIC FACTOR1, ADENOSINE 5'-MONOPHOSPHATE DEAMINASE, AMP deaminase, putative / myoadenylate deaminase, putative (.1.2) Lus10027814 [exp] 96 / 7e-25 AT2G38280 1280 / 0.0 EMBRYONIC FACTOR1, ADENOSINE 5'-MONOPHOSPHATE DEAMINASE, AMP deaminase, putative / myoadenylate deaminase, putative (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G101901.7 pacid=42768039 polypeptide=Potri.006G101901.7.p locus=Potri.006G101901 ID=Potri.006G101901.7.v4.1 annot-version=v4.1 ATGGCGGGTGGGAATTTCATGCACAGGGTCTTATCTTATGTTGTGAATGAGCTTGTCGTCAATGGTCTTGCTAACAGTCCTGCATTCCAGAGATTTGCAG TGAGGACATCGAGGAGGATTGATGATATTTCAAACATCGCGGCAAAGAAGAAGCAAGAACTTGCTGAGCAGATGAAAGACCTCTCCAAGAATATTGACTC TTTTAAGAACCAGCAGTAG
AA sequence Show only first row Show all	>Potri.006G101901.7 pacid=42768039 polypeptide=Potri.006G101901.7.p locus=Potri.006G101901 ID=Potri.006G101901.7.v4.1 annot-version=v4.1 MAGGNFMHRVLSYVVNELVVNGLANSPAFQRFAVRTSRRIDDISNIAAKKKQELAEQMKDLSKNIDSFKNQQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G01350			unknown protein		Potri.006G101901 [exp]	0	1
AT1G29810			Transcriptional coactivator/pt...		Potri.001G352800 [exp]	5.29	0.8491
AT3G55530		SDIR1	SALT- AND DROUGHT-INDUCED RING...		Potri.009G034700 [exp]	5.65	0.8736
AT4G08230			glycine-rich protein (.1.2)		Potri.005G174700 [exp]	6.48	0.8655
AT5G02040		PRA1.A1	prenylated RAB acceptor 1.A1 (...		Potri.006G091300 [exp]	6.70	0.8929
AT1G34470			Protein of unknown function (D...		Potri.009G047400 [exp]	7.34	0.8498
AT3G56850	bZIP	DPBF3, AREB3	ABA-responsive element binding...		Potri.001G220700 [exp]	7.41	0.8674
AT1G59740			Major facilitator superfamily ...		Potri.001G272900 [exp]	15.68	0.8786
AT1G32310			unknown protein		Potri.001G138700 [exp]	15.87	0.8661
AT3G48330		ATPIMT1, PIMT1	Arabidopsis thaliana protein-l...		Potri.012G090300 [exp]	16.00	0.8134
AT5G55290			ATPase, V0 complex, subunit E ...		Potri.001G359600 [exp]	17.05	0.7958

Compare expression of checked genes

Potri.006G101901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.