Potri.006G103000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07080 196 / 4e-62 Thioredoxin superfamily protein (.1)
AT5G01580 190 / 5e-60 OSH1 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12890 147 / 2e-43 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12900 144 / 2e-42 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12960 142 / 1e-41 GILT, AtGILT gamma-interferon-responsive lysosomal thiol reductase, Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1), Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.2)
AT4G12870 134 / 3e-38 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G122000 305 / 2e-105 AT1G07080 185 / 3e-58 Thioredoxin superfamily protein (.1)
Potri.016G121900 215 / 1e-69 AT5G01580 263 / 3e-89 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Potri.009G076200 196 / 3e-62 AT1G07080 278 / 3e-94 Thioredoxin superfamily protein (.1)
Potri.016G122200 189 / 2e-59 AT1G07080 204 / 3e-65 Thioredoxin superfamily protein (.1)
Potri.012G107300 189 / 2e-59 AT1G07080 205 / 1e-65 Thioredoxin superfamily protein (.1)
Potri.012G107600 188 / 6e-59 AT1G07080 204 / 2e-65 Thioredoxin superfamily protein (.1)
Potri.001G281004 185 / 4e-58 AT1G07080 266 / 8e-90 Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022670 219 / 3e-67 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10026384 196 / 5e-62 AT1G07080 281 / 1e-95 Thioredoxin superfamily protein (.1)
Lus10042270 195 / 1e-61 AT1G07080 285 / 5e-97 Thioredoxin superfamily protein (.1)
Lus10002203 192 / 5e-61 AT5G01580 238 / 2e-79 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Lus10012502 199 / 1e-59 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10022669 181 / 1e-56 AT1G07080 170 / 2e-52 Thioredoxin superfamily protein (.1)
Lus10012503 169 / 4e-52 AT1G07080 171 / 1e-52 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT)
Representative CDS sequence
>Potri.006G103000.1 pacid=42770500 polypeptide=Potri.006G103000.1.p locus=Potri.006G103000 ID=Potri.006G103000.1.v4.1 annot-version=v4.1
ATGCTTACAAAAATGGCTTCTGGGAAACTAGTATTCTCTTTCATCATTACTCTCCTGTTGATCTTCCTTCTACCTCCATCTCATGCTGCTTCTCATTCAG
ATCCTAGTGATATCAAGGATTCATCATCTATCAATCGTCAAAAGGTTAACCTCTCGGTTTATTATGAAGCTTTATGCCCATCCTGTGCAAACTTCATTGT
CCAAAGTCTTGCTAGGGTCTTCAACGATGATCTTATCAACATCATCAATCTCAGGATGGTACCATGGGGTAATGCTCATGTCAACAAAACTGACAGCACC
ATCATCTGTCAGAATGGTCTTGATGAATGTGTTCTGAATACAATACAAGCCTGCGCCATCAATGTCTGGCATGATGTGAACAAATATTATGCACTGATTT
ACTGCATTGAGTTCCTCACTATTGAGGGAAGGCATTCAAATTGGCAGTCTTGTTTCAGCTCACTTGGATTGCCTGAAAAACCTATTTTGGATTGTTACAA
CAATGGAACGGGAGCGAAGCTTCAAGCTCTATATGGTTATGAAACTGCACATCTTAGTCCGCCTCAGACGTTTGTGCCTTGGGTTGTCGTGGATAGTAAA
CAACTCGGAAATGACTATGAAAAATTTACCACCTACATCTGCAATGCATACAAAAGCAATGTCATACCAAATGCCTGCAAATCACTTCCACCGAATAATG
TCAGCTCAAGTAAGGAGGAAGATCCTATCCATCCAGTTTGCTACCGAGGTGAAGCTAAGAACTTGACATCTCTGGGACCAATAAAGAGAACTTGA
AA sequence
>Potri.006G103000.1 pacid=42770500 polypeptide=Potri.006G103000.1.p locus=Potri.006G103000 ID=Potri.006G103000.1.v4.1 annot-version=v4.1
MLTKMASGKLVFSFIITLLLIFLLPPSHAASHSDPSDIKDSSSINRQKVNLSVYYEALCPSCANFIVQSLARVFNDDLINIINLRMVPWGNAHVNKTDST
IICQNGLDECVLNTIQACAINVWHDVNKYYALIYCIEFLTIEGRHSNWQSCFSSLGLPEKPILDCYNNGTGAKLQALYGYETAHLSPPQTFVPWVVVDSK
QLGNDYEKFTTYICNAYKSNVIPNACKSLPPNNVSSSKEEDPIHPVCYRGEAKNLTSLGPIKRT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G07080 Thioredoxin superfamily protei... Potri.006G103000 0 1
AT3G23410 ATFAO3 ARABIDOPSIS FATTY ALCOHOL OXID... Potri.010G069100 7.21 0.7880
AT3G15395 unknown protein Potri.001G402000 9.84 0.7902
AT1G79450 ALIS5 ALA-interacting subunit 5 (.1.... Potri.001G381500 15.90 0.7570
Potri.010G058400 16.43 0.7135
AT1G73350 unknown protein Potri.004G066700 17.00 0.7422
AT3G01435 Expressed protein (.1) Potri.004G001600 17.74 0.7600
AT2G22600 RNA-binding KH domain-containi... Potri.007G012000 22.36 0.7574
AT2G45880 BZR BAM7, BMY4 BETA-AMYLASE 4, beta-amylase 7... Potri.001G372500 33.22 0.7328
AT4G36050 endonuclease/exonuclease/phosp... Potri.007G057400 34.79 0.6639
AT5G55000 FIP2 potassium channel tetramerisat... Potri.019G038400 34.95 0.7464

Potri.006G103000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.