Potri.006G103600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51750 40 / 8e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G124000 114 / 1e-32 AT3G51750 / unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002202 50 / 3e-08 AT3G51750 54 / 4e-10 unknown protein
PFAM info
Representative CDS sequence
>Potri.006G103600.1 pacid=42767878 polypeptide=Potri.006G103600.1.p locus=Potri.006G103600 ID=Potri.006G103600.1.v4.1 annot-version=v4.1
ATGGAAGATGGTGTGCCAGAAGCTGAAAGCTTGTTGCATCCTAAAGAGGAAGATGATGATGAGAAAGATAATCATCAAGAAAGTGGAGAAGAAAGGCCAA
GTGGGTCGTTCATAAACCATATCTTCTCTAACTTGGTCTCTAGAGGAGAAGCTGAACATCGTGAAGAAGAAGGTAAAGAAGAAGAGAATGAAGAGAAGGG
AGGTGGACTACTGGACAGTATCATCCCCAACTTGGTTTCTCCTTCGAGTAAAAAAGAAGAACAAAATGAAGCTTTCCAAGTTAGAGATGGTGAAGGAACA
AGTGAAGATCAAGTTAAAAAGAAACAGAAGGTAACAACAGTAGTTGATGAAGCAAATGAACGAGTGAAGGCTGAAGAGGAGGGTGGTGGAGGTATCATCG
ATCACATTGTTTCCCACTTTCCTACATCGCTTCCAGATGATGCTGTTCCAACAACTGACGAAGCAGCCATCCTCATTCACTCCATCATCCATGATTAA
AA sequence
>Potri.006G103600.1 pacid=42767878 polypeptide=Potri.006G103600.1.p locus=Potri.006G103600 ID=Potri.006G103600.1.v4.1 annot-version=v4.1
MEDGVPEAESLLHPKEEDDDEKDNHQESGEERPSGSFINHIFSNLVSRGEAEHREEEGKEEENEEKGGGLLDSIIPNLVSPSSKKEEQNEAFQVRDGEGT
SEDQVKKKQKVTTVVDEANERVKAEEEGGGGIIDHIVSHFPTSLPDDAVPTTDEAAILIHSIIHD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G51750 unknown protein Potri.006G103600 0 1
Potri.009G034150 3.46 0.6269
AT1G78090 ATTPPB Arabidopsis thaliana trehalose... Potri.015G020300 15.65 0.6295
AT2G30360 PKS5, CIPK11, S... SNF1-RELATED PROTEIN KINASE 3.... Potri.013G155600 22.62 0.5698
AT5G04250 Cysteine proteinases superfami... Potri.010G225400 24.49 0.6011
AT3G46920 Protein kinase superfamily pro... Potri.018G114300 27.11 0.6149
AT3G22060 Receptor-like protein kinase-r... Potri.017G040450 30.39 0.5481
AT1G02090 ATCSN7, COP15, ... FUSCA 5, CONSTITUTIVE PHOTOMOR... Potri.001G153900 34.64 0.5310
AT3G12830 SAUR-like auxin-responsive pro... Potri.005G096400 41.89 0.5275
AT1G80610 unknown protein Potri.017G053900 44.69 0.5671
AT1G08800 Protein of unknown function, D... Potri.019G012200 46.24 0.5631

Potri.006G103600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.