Plant FIBer expression Database

Potri.006G103700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58420 466 / 2e-168 Ribosomal protein S4 (RPS4A) family protein (.1)
AT5G07090 465 / 4e-168 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
AT2G17360 463 / 2e-167 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G124100
[exp]
489 / 1e-177 AT5G58420 458 / 2e-165 Ribosomal protein S4 (RPS4A) family protein (.1)
Potri.015G033700
[exp]
489 / 2e-177 AT5G07090 468 / 3e-169 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Potri.013G011000
[exp]
483 / 3e-175 AT2G17360 452 / 6e-163 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Potri.015G079600
[exp]
481 / 2e-174 AT5G07090 460 / 4e-166 Ribosomal protein S4 (RPS4A) family protein (.1), Ribosomal protein S4 (RPS4A) family protein (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004272
[exp]
452 / 9e-163 AT5G58420 499 / 0.0 Ribosomal protein S4 (RPS4A) family protein (.1)
Lus10019239
[exp]
451 / 2e-153 AT2G22660 747 / 0.0 Protein of unknown function (duplicated DUF1399) (.1), Protein of unknown function (duplicated DUF1399) (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF00467 KOW KOW motif
CL0021 OB PF00900 Ribosomal_S4e Ribosomal family S4e
CL0492 S4 PF01479 S4 S4 domain
CL0492 PF08071 RS4NT RS4NT (NUC023) domain
CL0492 PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus
Representative CDS sequence
>Potri.006G103700.1 pacid=42769692 polypeptide=Potri.006G103700.1.p locus=Potri.006G103700 ID=Potri.006G103700.1.v4.1 annot-version=v4.1
ATGGCTAGAGGGTTGAAGAAACACTTGAAGAGGCTCAATGCTCCTAAACATTGGATGCTTGACAAACTTGGTGGTGCATTTGCACCCAAACCCTCATCTG
GACCCCACAAATCAAGGGAATGCTTGCCTCTGATTCTCATTTTGCGAAACAGGCTGAAGTATGCTTTGACGTACCGTGAAGTGATAGCTATTTTGATGCA
GAGACATGTTCTGGTTGATGGGAAGGTTAGGACAGATAAAACTTACCCATCTGGTTTCATGGATGTTGTGTCAATCCCAAAGACAAATGAGAGCTTCCGT
CTGCTCTATGACACCAAAGGTCGCTTCCGGCTTCACTCCCTTAGAGATGACGAGGCCAAGTTTAAGCTTTGCAAAGTTCGGTCTATTCAGTTTGGGCAGA
AAGGGATCCCTTACCTGAACACCTATGATGGACGCACCATCCGCTACCCAGATCCCCTCATTAAGGCCAATGACACCATCAAGCTGGACCTAGAGAGCAA
CAAAATAGTTGACTTCATCAAGTTTGATGTGGGAAATGTTGTCATGGTCACTGGAGGAAGGAACAGAGGCCGAGTTGGAGTAATTAAGAACAGGGAGAAG
CATAAGGGAAGCTTTGAGACGATCCATGTTCAAGATGCCACTGGCCATGAGTTCGCCACTCGTTTGGGCAATGTGTTCACCATTGGAAAGGGCTCCAAGC
CATGGATTTCTCTTCCCAAGGGCAAGGGTATTAAATTGTCTATCATTGAGGAGGCTAGAAAGAGGCAGGCAGCATCCCAAACTGCTGCATGA
AA sequence
>Potri.006G103700.1 pacid=42769692 polypeptide=Potri.006G103700.1.p locus=Potri.006G103700 ID=Potri.006G103700.1.v4.1 annot-version=v4.1
MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFR
LLYDTKGRFRLHSLRDDEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLDLESNKIVDFIKFDVGNVVMVTGGRNRGRVGVIKNREK
HKGSFETIHVQDATGHEFATRLGNVFTIGKGSKPWISLPKGKGIKLSIIEEARKRQAASQTAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G58420 Ribosomal protein S4 (RPS4A) f... Potri.006G103700
[exp]
0 1
AT4G14320 Zinc-binding ribosomal protein... Potri.005G092500
[exp]
4.00 0.9658
AT1G43170 RPL3A, ARP1, EM... embryo defective 2207, ribosom... Potri.005G194500
[exp]
4.47 0.9657 ARP1.1
AT2G34480 Ribosomal protein L18ae/LX fam... Potri.002G057600
[exp]
4.58 0.9651 RPL18.7
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Potri.017G101000
[exp]
5.47 0.9626 Pt-RPL7.7
AT5G28060 Ribosomal protein S24e family ... Potri.008G152500
[exp]
7.34 0.9615
AT3G05590 RPL18 ribosomal protein L18 (.1) Potri.014G127300
[exp]
8.48 0.9640 RPL18.10
AT5G07090 Ribosomal protein S4 (RPS4A) f... Potri.015G079600
[exp]
9.64 0.9394
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Potri.010G167700
[exp]
10.58 0.9479
AT2G09990 Ribosomal protein S5 domain 2-... Potri.008G150000
[exp]
10.90 0.9590
AT5G59240 Ribosomal protein S8e family p... Potri.001G262100
[exp]
10.95 0.9475 RPS8.3

Potri.006G103700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.