Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22380 98 / 9e-26 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT1G22360 96 / 5e-25 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT1G22370 94 / 4e-24 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2) AT1G22400 92 / 1e-23 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) AT1G22340 91 / 4e-23 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G78270 86 / 2e-21 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1) AT3G02100 46 / 2e-07 UDP-Glycosyltransferase superfamily protein (.1) AT5G05860 39 / 6e-05 UGT76C2 UDP-glucosyl transferase 76C2 (.1) AT3G46660 39 / 6e-05 UGT76E12 UDP-glucosyl transferase 76E12 (.1) AT5G05900 39 / 0.0001 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G312600 [exp] 114 / 1e-31 AT1G22360 586 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052166 [exp] 113 / 3e-31 AT1G22360 607 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052300 [exp] 111 / 1e-30 AT1G22360 603 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G020500 [exp] 108 / 1e-29 AT1G22380 527 / 0.0 UDP-glucosyl transferase 85A3 (.1) Potri.016G020900 [exp] 108 / 2e-29 AT1G22380 538 / 0.0 UDP-glucosyl transferase 85A3 (.1) Potri.002G098400 [exp] 106 / 7e-29 AT1G22360 640 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.001G313000 [exp] 103 / 1e-27 AT1G22360 564 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.016G021000 [exp] 101 / 5e-27 AT1G22360 561 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.006G022800 [exp] 100 / 8e-27 AT1G22400 470 / 1e-163 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041055 [exp] 98 / 2e-25 AT1G22360 610 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Lus10007421 [exp] 96 / 8e-25 AT1G22400 529 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10019364 [exp] 96 / 8e-25 AT1G22400 523 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10024584 [exp] 95 / 2e-24 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10013652 [exp] 90 / 1e-22 AT1G22360 359 / 3e-121 UDP-glucosyl transferase 85A2 (.1.2) Lus10000993 [exp] 90 / 1e-22 AT1G22380 563 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10013925 [exp] 87 / 1e-21 AT1G22380 560 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10035903 [exp] 87 / 1e-21 AT1G22360 522 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Lus10024583 [exp] 87 / 1e-21 AT1G22380 598 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10032218 [exp] 87 / 1e-21 AT1G22380 564 / 0.0 UDP-glucosyl transferase 85A3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G103850.1 pacid=42767979 polypeptide=Potri.006G103850.1.p locus=Potri.006G103850 ID=Potri.006G103850.1.v4.1 annot-version=v4.1 ATGCTAAAGCTATCTAAACTCCTACATTTTAAAGGCTTCCAAATAACCTTTGTCAACACTGAGTATAGCCACAAACGACTACTCAAATCCAGAGGTTCCG ACTCTCTGGATGGCTTACCGGACTTCCAGTTTGAAGCTATACCTGATGGTCTCCTACAGACAGAAGATTCTGATGCCACTCGGGACATTCCTTCTGCCTG TGAATCCATTCCGCAATTTACTTCACTGGCTCAATGA
AA sequence Show only first row Show all	>Potri.006G103850.1 pacid=42767979 polypeptide=Potri.006G103850.1.p locus=Potri.006G103850 ID=Potri.006G103850.1.v4.1 annot-version=v4.1 MLKLSKLLHFKGFQITFVNTEYSHKRLLKSRGSDSLDGLPDFQFEAIPDGLLQTEDSDATRDIPSACESIPQFTSLAQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Potri.006G103850 [exp]	0	1
AT1G75490	AP2_ERF	DREB2D	Integrase-type DNA-binding sup...		Potri.002G029400 [exp]	4.12	0.9306
AT2G46950		CYP709B2	"cytochrome P450, family 709, ...		Potri.006G022200 [exp]	6.00	0.9295	Pt-CYP709.2
AT1G23420	YABBY	INO, YAB4	INNER NO OUTER, Plant-specific...		Potri.010G042400 [exp]	10.09	0.9295	Pt-INO.2
AT1G75490	AP2_ERF	DREB2D	Integrase-type DNA-binding sup...		Potri.005G233300 [exp]	10.95	0.9247
					Potri.015G076300 [exp]	11.00	0.9224
					Potri.001G459001 [exp]	13.07	0.9283
AT1G05380			Acyl-CoA N-acyltransferase wit...		Potri.001G153200 [exp]	13.41	0.8816
AT5G06860		ATPGIP1, PGIP1	polygalacturonase inhibiting p...		Potri.016G049600 [exp]	13.49	0.9156	PGIP.2
AT1G04645			Plant self-incompatibility pro...		Potri.018G148366 [exp]	14.28	0.9213
AT5G01600		ATFER1	ARABIDOPSIS THALIANA FERRETIN ...		Potri.006G103900 [exp]	15.29	0.9171

Compare expression of checked genes

Potri.006G103850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.