Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38310 248 / 6e-84 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT2G40330 232 / 2e-77 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT5G05440 230 / 5e-77 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G53160 186 / 8e-60 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT2G26040 186 / 1e-59 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT1G01360 184 / 6e-59 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT4G17870 177 / 4e-56 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G01026 176 / 2e-55 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT4G27920 173 / 1e-54 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT1G73000 162 / 3e-50 RCAR13, PYL3 regulatory components of ABA receptor 13, PYR1-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G125400 [exp] 350 / 3e-124 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.010G183900 [exp] 253 / 1e-85 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Potri.008G073400 [exp] 248 / 7e-84 AT2G38310 229 / 2e-76 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.018G054400 [exp] 189 / 8e-61 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.006G230600 [exp] 188 / 1e-60 AT2G26040 266 / 6e-92 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.001G142500 [exp] 188 / 3e-60 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.003G139200 [exp] 184 / 5e-59 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.003G091700 [exp] 184 / 9e-59 AT4G17870 273 / 3e-94 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.012G000800 [exp] 182 / 4e-58 AT5G53160 303 / 1e-106 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014239 [exp] 298 / 2e-103 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 298 / 2e-102 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10012231 [exp] 263 / 1e-89 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 211 / 2e-70 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10002861 [exp] 208 / 3e-68 AT2G38310 176 / 7e-56 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007275 [exp] 194 / 9e-63 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10029222 [exp] 191 / 8e-62 AT2G40330 182 / 2e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10001059 [exp] 186 / 1e-59 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10026430 [exp] 184 / 1e-58 AT2G26040 264 / 1e-90 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10024991 [exp] 182 / 5e-58 AT2G26040 264 / 7e-91 regulatory components of ABA receptor 14, PYR1-like 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF10604 [poplar] [flax] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Potri.006G104100.1 pacid=42768780 polypeptide=Potri.006G104100.1.p locus=Potri.006G104100 ID=Potri.006G104100.1.v4.1 annot-version=v4.1 ATGCCTGCTAATCCTCCAAAATCATCTCTTTTAATCCATAGAATCAACAACACCACCATAACTAACACAACCCTAAACACCACGAATACAACCACCTCAA CTTCATGCCAAAAACGGTGGTCCCCTCTAACATGCGCCACCATCCCAGTTCCAGAAACCGTTTCACGCTATCACGCCCACGCTGTAGGCCCCAACCAGTG CTGCTCTGCCGTGGTACAACAAATCGCTGCCCCGGTCTCCACTGTATGGTCTGTCGTTCGCCACTTCGACAACCCACAAGCTTATAAACATTTCGTCAAG AGCTGCCACGTCATCCTCGGAGACGGTGACGTGGGTACTCTCCGTGAGGTCCACGTCATCTCCGGTCTCCCAGCTGCTAAGAGCACCGAACGCCTCGAGA TCCTTGACCATGAACGACATGTCATTAGCTTTAGTGTTGTGGGTGGGGACCATAGACTTGCGAACTACAGGTCGGTTACAACTCTCCATGCGTCACCCAC AGGTAACGGCACCGTCGTCGTGGAGTCTTACGTGGTAGATATTCCGCCGGGAAATACTAAAGAGGACACGTGTGTGTTTGTAGATACCATAGTTCGGTGC AACCTCCAGTCACTGGCACAGATCGCGGAGAACAAGAATAGACGCAATAATAAATCATCATCGTGA
AA sequence Show only first row Show all	>Potri.006G104100.1 pacid=42768780 polypeptide=Potri.006G104100.1.p locus=Potri.006G104100 ID=Potri.006G104100.1.v4.1 annot-version=v4.1 MPANPPKSSLLIHRINNTTITNTTLNTTNTTTSTSCQKRWSPLTCATIPVPETVSRYHAHAVGPNQCCSAVVQQIAAPVSTVWSVVRHFDNPQAYKHFVK SCHVILGDGDVGTLREVHVISGLPAAKSTERLEILDHERHVISFSVVGGDHRLANYRSVTTLHASPTGNGTVVVESYVVDIPPGNTKEDTCVFVDTIVRC NLQSLAQIAENKNRRNNKSSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Potri.006G104100 [exp]	0	1
AT5G50900			ARM repeat superfamily protein...		Potri.012G104400 [exp]	2.82	0.9144
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Potri.016G125400 [exp]	5.09	0.9076
AT4G01250	WRKY	ATWRKY22, WRKY2...	WRKY family transcription fact...		Potri.003G132700 [exp]	5.83	0.9371
AT2G45360			Protein of unknown function (D...		Potri.014G068900 [exp]	10.00	0.9269
AT1G71980			Protease-associated (PA) RING/...		Potri.019G082500 [exp]	10.14	0.8490
AT3G22800			Leucine-rich repeat (LRR) fami...		Potri.010G083000 [exp]	12.80	0.9199
AT5G10530			Concanavalin A-like lectin pro...		Potri.001G283212 [exp]	14.89	0.9155
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Potri.010G139400 [exp]	16.24	0.9257
AT2G38300	GARP		myb-like HTH transcriptional r...		Potri.004G057900 [exp]	17.14	0.9149
AT5G10530			Concanavalin A-like lectin pro...		Potri.001G283400 [exp]	22.04	0.9141	LEC.4

Compare expression of checked genes

Potri.006G104100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.