Potri.006G104400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38360 206 / 3e-67 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT5G01640 174 / 1e-54 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT3G56110 172 / 6e-54 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT5G05380 164 / 1e-50 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT2G40380 159 / 7e-49 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT5G07110 143 / 1e-42 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
AT4G00005 74 / 1e-16 PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G55190 74 / 4e-16 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G08770 70 / 2e-14 PRA1.E prenylated RAB acceptor 1.E (.1)
AT1G04260 69 / 2e-14 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G126400 275 / 4e-94 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Potri.008G074000 188 / 2e-60 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.008G074033 188 / 2e-60 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.010G183300 184 / 9e-59 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.019G124100 159 / 7e-49 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1)
Potri.005G219100 98 / 2e-25 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G044000 97 / 4e-25 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G054700 89 / 9e-22 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
Potri.002G043800 84 / 8e-20 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012224 206 / 6e-67 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1)
Lus10002853 199 / 7e-64 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
Lus10042246 181 / 7e-57 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10026404 177 / 1e-55 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1)
Lus10017425 166 / 3e-51 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10007533 164 / 6e-51 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10009842 162 / 4e-50 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1)
Lus10022680 147 / 1e-44 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1)
Lus10014234 99 / 4e-26 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1)
Lus10014747 84 / 2e-19 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Potri.006G104400.1 pacid=42770229 polypeptide=Potri.006G104400.1.p locus=Potri.006G104400 ID=Potri.006G104400.1.v4.1 annot-version=v4.1
ATGTCATCCCAGTCTCCGCCAGTCCTCCCGATCACAAACCAGCAACAACCACCCGCCGCTGCCGCCTCCCAACCACCTCTCCCTCCACACGCCCTCCGCG
CATTCCTCAACAACATTACCGAATCCGTCCGCAACGGTTTCGCCCAACGCCGCCCCTTTTCCGAACTAATCGACCGATCCGCTTTCTCTAAACCTGAATC
CATATCCGAAGCCACAACTCGCATCCGTAAAAACTACTCCTACTTCCGCATCAACTATCTTACCGCTATTTCCGTAATCCTCGCATTTTCCCTCCTTTCT
CACCCTTTCTCTCTCCTCCTCCTCCTCGGCCTGCTCTGTTCTTGGCTTTTCTTGTATCTCTTCCGCGCTTCGGATCAGCCTTTGGTCCTCTTCGGCCGGA
CTTATAGTGACCGTGAAACGCTCGGGATTCTGATTGCATTGAGTGTTTTCGTGGTTTTTCTAACTAGTGTCGGATCTGTGATAATATCGGCGCTTTTGGT
CGGTGTTGGGATCGTTTGTGCTCATGGTGCTTTTCGTGTTCCTGAGGATCTTTTCTTGGACGACGTTCCAGAAAATGCAAACACTGGCTTCTTGTCTTCC
TTCCTCGGCAGCGCTGCCTCCAATGTTGTTTCCTCTGCGGCGCCTCTTGTGGCAGCCGCCCGTGTTTGA
AA sequence
>Potri.006G104400.1 pacid=42770229 polypeptide=Potri.006G104400.1.p locus=Potri.006G104400 ID=Potri.006G104400.1.v4.1 annot-version=v4.1
MSSQSPPVLPITNQQQPPAAAASQPPLPPHALRAFLNNITESVRNGFAQRRPFSELIDRSAFSKPESISEATTRIRKNYSYFRINYLTAISVILAFSLLS
HPFSLLLLLGLLCSWLFLYLFRASDQPLVLFGRTYSDRETLGILIALSVFVVFLTSVGSVIISALLVGVGIVCAHGAFRVPEDLFLDDVPENANTGFLSS
FLGSAASNVVSSAAPLVAAARV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Potri.006G104400 0 1
AT5G18520 Lung seven transmembrane recep... Potri.016G081300 3.60 0.9339
AT2G18840 Integral membrane Yip1 family ... Potri.018G093800 5.19 0.9145
AT5G64090 unknown protein Potri.003G020500 5.83 0.8949
AT5G60020 LAC17, ATLAC17 laccase 17 (.1) Potri.006G087500 8.00 0.9294 LAC110c
AT4G30260 Integral membrane Yip1 family ... Potri.006G169200 8.77 0.9087
Potri.009G092300 9.38 0.9271 AGP9.1
AT4G17890 UBP20, AGD8 ARF-GAP domain 8 (.1.2) Potri.001G142100 12.36 0.9284 UBP20.2
AT5G54430 ATPHOS32 Adenine nucleotide alpha hydro... Potri.011G125500 13.85 0.8814
AT1G68725 AGP19, ATAGP19 arabinogalactan protein 19 (.1... Potri.010G132500 14.45 0.9047
AT4G01400 unknown protein Potri.002G179600 15.87 0.9086

Potri.006G104400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.