Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) AT5G01650 130 / 1e-40 Tautomerase/MIF superfamily protein (.1.2) AT5G57170 97 / 2e-27 Tautomerase/MIF superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G127300 [exp] 219 / 8e-76 AT3G51660 151 / 7e-49 Tautomerase/MIF superfamily protein (.1) Potri.006G104500 [exp] 129 / 5e-40 AT5G01650 200 / 5e-68 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126500 [exp] 126 / 6e-39 AT5G01650 193 / 2e-65 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126600 [exp] 126 / 7e-39 AT5G01650 216 / 2e-74 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126800 [exp] 122 / 2e-37 AT5G01650 185 / 4e-62 Tautomerase/MIF superfamily protein (.1.2) Potri.006G104600 [exp] 118 / 1e-35 AT5G01650 180 / 3e-60 Tautomerase/MIF superfamily protein (.1.2) Potri.016G126700 [exp] 109 / 2e-32 AT5G01650 164 / 6e-54 Tautomerase/MIF superfamily protein (.1.2) Potri.006G075100 [exp] 97 / 2e-27 AT5G57170 194 / 7e-66 Tautomerase/MIF superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012222 [exp] 170 / 3e-56 AT3G51660 158 / 1e-51 Tautomerase/MIF superfamily protein (.1) Lus10022681 [exp] 116 / 7e-35 AT5G01650 172 / 8e-57 Tautomerase/MIF superfamily protein (.1.2) Lus10014233 [exp] 115 / 3e-34 AT5G01650 169 / 1e-55 Tautomerase/MIF superfamily protein (.1.2) Lus10000344 [exp] 100 / 5e-29 AT3G51660 96 / 2e-27 Tautomerase/MIF superfamily protein (.1) Lus10012223 [exp] 97 / 2e-27 AT5G01650 146 / 9e-47 Tautomerase/MIF superfamily protein (.1.2) Lus10033324 [exp] 63 / 2e-13 AT5G57170 119 / 1e-35 Tautomerase/MIF superfamily protein (.1.2) Lus10034783 [exp] 59 / 4e-12 AT5G57170 116 / 4e-34 Tautomerase/MIF superfamily protein (.1.2) Lus10000345 [exp] 38 / 0.0005 AT5G01650 52 / 2e-11 Tautomerase/MIF superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0082 [poplar] [flax] MIF PF01187 [poplar] [flax] MIF Macrophage migration inhibitory factor (MIF)
Representative CDS sequence Show only first row Show all	>Potri.006G104800.1 pacid=42770638 polypeptide=Potri.006G104800.1.p locus=Potri.006G104800 ID=Potri.006G104800.1.v4.1 annot-version=v4.1 ATGCCTTGCCTTTATATCTCTACCAACGTCAACCTTGACGATGTTGATAAGGATCCTATCTTCTCCGAGGCAACAAAAGCTGTTGCTACCATCATCGGCA GACCTGAACACCTTGTGATGGTCATACTGAAAGGACTGGTGGCCATATCATTCAATGGGAACAAAGAACCAGCTGCATATGCAGAGATTGTGTCAATGGG TGGCATTACCAAACAAGTTAAGAGGAATCTAATAGCTACTCTTGGCACAATTCTTGAGGCCAAGTTATCTATCCCCAGGGCACGATTCTTCCTTAAAGTT TATGATACAACAGCTGCTGGTAACAGCTCCAAGTTGTAG
AA sequence Show only first row Show all	>Potri.006G104800.1 pacid=42770638 polypeptide=Potri.006G104800.1.p locus=Potri.006G104800 ID=Potri.006G104800.1.v4.1 annot-version=v4.1 MPCLYISTNVNLDDVDKDPIFSEATKAVATIIGRPEHLVMVILKGLVAISFNGNKEPAAYAEIVSMGGITKQVKRNLIATLGTILEAKLSIPRARFFLKV YDTTAAGNSSKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G51660			Tautomerase/MIF superfamily pr...		Potri.006G104800 [exp]	0	1
AT2G01080			Late embryogenesis abundant (L...		Potri.001G208000 [exp]	2.64	0.8167
AT3G52750		FTSZ2-2	Tubulin/FtsZ family protein (....		Potri.006G083100 [exp]	5.47	0.7664
AT3G54440			glycoside hydrolase family 2 p...		Potri.003G196500 [exp]	9.79	0.7720
AT1G11380			PLAC8 family protein (.1)		Potri.004G026700 [exp]	12.64	0.7499
AT1G66140	C2H2ZnF	ZFP4	zinc finger protein 4 (.1)		Potri.008G138000 [exp]	13.78	0.7475
AT3G26430			GDSL-like Lipase/Acylhydrolase...		Potri.001G074400 [exp]	16.37	0.7876	ENOD8.2
AT1G76880	Trihelix		Duplicated homeodomain-like su...		Potri.002G068600 [exp]	25.21	0.7469	GT2.3
AT4G20800			FAD-binding Berberine family p...		Potri.001G459500 [exp]	28.28	0.7134
AT3G08943			ARM repeat superfamily protein...		Potri.016G123600 [exp]	30.88	0.6811
AT3G20480		AtLpxK	lipid X K, tetraacyldisacchari...		Potri.001G418800 [exp]	34.64	0.7388

Compare expression of checked genes

Potri.006G104800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.