Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05975 127 / 4e-37 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G54200 75 / 2e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G46150 74 / 2e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G23930 58 / 2e-10 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) AT3G44380 52 / 2e-08 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G01080 42 / 0.0001 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G44000 40 / 0.0004 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G142200 [exp] 258 / 2e-88 AT3G05975 105 / 2e-28 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G142300 [exp] 102 / 6e-27 AT3G54200 162 / 3e-50 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G112800 [exp] 94 / 9e-24 AT3G54200 159 / 7e-49 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G230400 [exp] 81 / 5e-19 AT2G46150 82 / 3e-19 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G025100 [exp] 79 / 4e-18 AT2G46150 77 / 3e-17 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G165100 [exp] 72 / 1e-15 AT2G46150 184 / 1e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.001G098100 [exp] 66 / 6e-13 AT2G46150 171 / 2e-53 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.003G133400 [exp] 65 / 8e-13 AT2G46150 164 / 7e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.003G141200 [exp] 61 / 2e-11 AT4G23930 176 / 3e-56 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035612 [exp] 88 / 4e-21 AT3G54200 142 / 8e-42 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10003238 [exp] 87 / 9e-21 AT3G54200 143 / 3e-42 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10043084 [exp] 86 / 1e-20 AT3G54200 141 / 2e-41 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018185 [exp] 84 / 3e-20 AT3G54200 153 / 9e-47 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10032671 [exp] 85 / 4e-20 AT3G54200 141 / 1e-41 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10025649 [exp] 79 / 5e-18 AT3G54200 152 / 2e-46 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006764 [exp] 76 / 5e-17 AT3G54200 79 / 5e-18 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007904 [exp] 76 / 1e-16 AT2G46150 159 / 1e-48 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018361 [exp] 75 / 1e-16 AT3G54200 91 / 1e-22 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007649 [exp] 72 / 2e-15 AT3G54200 85 / 2e-20 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.006G112700.2 pacid=42767223 polypeptide=Potri.006G112700.2.p locus=Potri.006G112700 ID=Potri.006G112700.2.v4.1 annot-version=v4.1 ATGATAGAAACTAATGACCGAGGACATGATCCCAAGGCCAGGAGAAGAAGGTGTTTCATTGTTGGTGGGGTAATTCTCCTCTTGCTGCTGCTGCTATTCA TTATTGTTCTCATCCTTGCCCTGACAGTTTTCAAGCCTAAAGAGCCCAGAACCGAGCTGCTATCGGCTACCCTCGAAGGCATCTCTCCTCGCATCTCATT CTCTCCTGTTAGTATCCAACTTAACATCTTCCTCAATCTCACACTCCTCGTCAAAAATCCTAACCATGCCAGCTTCAAGCATGGCCCTGGAAAGAGCTAC CTTCTATATCAAGGCGACCAGGTGGGAGAGGCTGACTTGTGCCCGGGCCTGATACCCTCTAAGGGGACTCAGACACTTCCTTCCCAGCTTACCATAGAGG TGGATGAGATGGCAACTCATATTTCAGCTTTAATCAGTGATGTTCTGCAAGGGCAGCTTGTTATTGAAACACGAACGAGAATTCCTGGCAGGGTCTCCTT CCTGAAGATATTCAAAAAGCATGCTGTTGCTACTTCTGATTGCCGACTCGCTATTGCTATTCCTTCCATGAAGATTCAAAGCCAAGAATGCGAGAGCAAG ACTAAGTTATGA
AA sequence Show only first row Show all	>Potri.006G112700.2 pacid=42767223 polypeptide=Potri.006G112700.2.p locus=Potri.006G112700 ID=Potri.006G112700.2.v4.1 annot-version=v4.1 MIETNDRGHDPKARRRRCFIVGGVILLLLLLLFIIVLILALTVFKPKEPRTELLSATLEGISPRISFSPVSIQLNIFLNLTLLVKNPNHASFKHGPGKSY LLYQGDQVGEADLCPGLIPSKGTQTLPSQLTIEVDEMATHISALISDVLQGQLVIETRTRIPGRVSFLKIFKKHAVATSDCRLAIAIPSMKIQSQECESK TKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05975			Late embryogenesis abundant (L...		Potri.006G112700 [exp]	0	1
AT3G18570			Oleosin family protein (.1)		Potri.012G059400 [exp]	2.00	0.8433
AT2G46300			Late embryogenesis abundant (L...		Potri.002G167300 [exp]	3.00	0.8208
AT4G13030			P-loop containing nucleoside t...		Potri.002G199700 [exp]	10.86	0.7448
AT3G44900		ATCHX4	cation/H+ exchanger 4, cation/...		Potri.006G176400 [exp]	15.16	0.7043
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Potri.002G078600 [exp]	23.13	0.8338	ACO1
AT4G27730		ATOPT6	ARABIDOPSIS THALIANA OLIGOPEPT...		Potri.012G019500 [exp]	24.73	0.8310
AT5G41210		GSTU12, GST10, ...	glutathione S-transferase THET...		Potri.001G105600 [exp]	26.72	0.7173	ATGSTT1.3
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Potri.006G160700 [exp]	27.74	0.8174
AT2G13570	CCAAT	NF-YB7	"nuclear factor Y, subunit B7"...		Potri.007G103901 [exp]	29.39	0.8245
AT5G66900			Disease resistance protein (CC...		Potri.007G038700 [exp]	32.72	0.7983

Compare expression of checked genes

Potri.006G112700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.