Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09925 179 / 9e-58 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G05500 51 / 4e-08 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT2G47530 48 / 5e-07 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G28290 47 / 3e-06 AGP31 arabinogalactan protein 31 (.1.2) AT5G15780 44 / 3e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT2G33790 43 / 5e-05 ATAGP30 arabinogalactan protein 30 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G185400 [exp] 58 / 1e-10 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 53 / 2e-08 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G053600 [exp] 51 / 7e-08 AT2G34700 139 / 5e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G100600 [exp] 52 / 8e-08 AT5G15780 173 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G044700 [exp] 48 / 8e-07 AT2G34700 142 / 8e-43 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G201900 [exp] 44 / 1e-05 AT2G47540 160 / 1e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.006G005600 [exp] 43 / 4e-05 AT5G47635 120 / 8e-35 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.016G006200 [exp] 40 / 0.0003 AT5G47635 117 / 2e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 39 / 0.0007 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023887 [exp] 203 / 7e-67 AT3G09925 167 / 4e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014394 [exp] 115 / 8e-33 AT3G09925 104 / 6e-29 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10040948 [exp] 61 / 1e-11 AT5G05500 176 / 9e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10009837 [exp] 59 / 8e-11 AT5G05500 171 / 1e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017440 [exp] 54 / 6e-09 AT5G05500 128 / 7e-38 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10015434 [exp] 53 / 3e-08 AT1G28290 135 / 1e-39 arabinogalactan protein 31 (.1.2) Lus10007515 [exp] 49 / 3e-07 AT5G05500 127 / 3e-37 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10034365 [exp] 49 / 8e-07 AT5G15780 129 / 7e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014013 [exp] 47 / 4e-06 AT2G34700 137 / 2e-40 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10005086 [exp] 45 / 1e-05 AT5G15780 133 / 5e-35 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [poplar] [flax] Transthyretin PF01190 [poplar] [flax] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Potri.006G119100.2 pacid=42769938 polypeptide=Potri.006G119100.2.p locus=Potri.006G119100 ID=Potri.006G119100.2.v4.1 annot-version=v4.1 ATGTACATATATGGCCTTCTTGTAAGCAAGGATTTAGTCTCTTTAATCTATCAGGAGCGAGAGAGAAAACAAAGAAAGATGGCAGCTCCTATTTTGACGT TGATTGCAGCATCTCTTCTGGTGGGATGCACCACTTTAGCCATGGCTTGGGAGGAAACTTATGGGGTCATAAATGTTGCCGGGAAAGTAATGTGCCAGGA CTGCACCAAGGGTTATAATGACTGGATTAATGGCGACAGGCCCATTAAAGGGAGTAAAGTATGCCTTACATGCACTGATGATAGAGGCAGAGTAATACAT TACGATAGTGATGTGACAGATGAAAGAGGAGAATTTGACATGATAGTGAGCAAATACATTAATGGGAAGCAACTGAAGGAGAAGAAATGCTCAGTGAGGC TTGTATCATCACCAGACCCTAGTTGTAACATCCTCACCGACTTTGCTGGTGGGAAATCAGGAGTGAAGCTCAAGCGACCCACTTCCGTGTACCGTGACAC CGTTAAATACATGCTCACTCCATTTTACTTCACGTCTCCAATGTGTGAGGAGCCTGATACTACTGATCAGTACGATGACACCCAAGGAAACAATTACTGA
AA sequence Show only first row Show all	>Potri.006G119100.2 pacid=42769938 polypeptide=Potri.006G119100.2.p locus=Potri.006G119100 ID=Potri.006G119100.2.v4.1 annot-version=v4.1 MYIYGLLVSKDLVSLIYQERERKQRKMAAPILTLIAASLLVGCTTLAMAWEETYGVINVAGKVMCQDCTKGYNDWINGDRPIKGSKVCLTCTDDRGRVIH YDSDVTDERGEFDMIVSKYINGKQLKEKKCSVRLVSSPDPSCNILTDFAGGKSGVKLKRPTSVYRDTVKYMLTPFYFTSPMCEEPDTTDQYDDTQGNNY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09925			Pollen Ole e 1 allergen and ex...		Potri.006G119100 [exp]	0	1
AT2G04100			MATE efflux family protein (.1...		Potri.017G120500 [exp]	6.40	0.9859
AT1G01800			NAD(P)-binding Rossmann-fold s...		Potri.002G156866 [exp]	7.21	0.9831
AT3G22930		CML11	calmodulin-like 11 (.1)		Potri.002G047300 [exp]	11.48	0.9788	Pt-ACCAL.7
AT1G21270		WAK2	wall-associated kinase 2 (.1)		Potri.009G155050 [exp]	13.03	0.9495
AT4G37680		HHP4	heptahelical protein 4 (.1.2)		Potri.007G005800 [exp]	14.69	0.9647
AT2G38870			Serine protease inhibitor, pot...		Potri.010G075800 [exp]	20.34	0.9779
					Potri.006G128300 [exp]	21.16	0.9778
AT1G48780			unknown protein		Potri.012G055300 [exp]	22.47	0.9422
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Potri.001G033800 [exp]	23.04	0.9055
					Potri.005G176466 [exp]	24.49	0.8917

Compare expression of checked genes

Potri.006G119100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.