Potri.006G122200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36835 194 / 1e-65 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023919 204 / 2e-69 AT2G36835 193 / 3e-65 unknown protein
Lus10014416 176 / 1e-57 AT2G36835 167 / 4e-54 unknown protein
PFAM info
Representative CDS sequence
>Potri.006G122200.1 pacid=42769190 polypeptide=Potri.006G122200.1.p locus=Potri.006G122200 ID=Potri.006G122200.1.v4.1 annot-version=v4.1
ATGTCAAAAAAAGGAGGAACAACCCCTGGGCTTCAAAAGGATGTCCCATGGAGAGTATCAACTTCAAAACCCATTCCCAAAATTCACCACTCTCCTATTC
TCCGCGTCTCTCAAAACCCATTTTGCGATTATGCCCTCTCTGTCATGAAGCACCCTAATCCCATTGGAACTGGCTTAGCTACTGAAGCGCTTGTGGAAGC
TGCTGGTCCTGATTGTATCGTCCCTGGCCAGATTACACCCTTTCGTGTACTTGGTCTTAAGGTTTGGCCTATTGAGTTTGACTTGAAGTTTATGGAACCT
GTTGGACGAGAACTTAAGTTACTTGGAAAGTTCATGGATGATGCTGTCAACCTGATGAACAAGTCATTTGTAGACCGCTAG
AA sequence
>Potri.006G122200.1 pacid=42769190 polypeptide=Potri.006G122200.1.p locus=Potri.006G122200 ID=Potri.006G122200.1.v4.1 annot-version=v4.1
MSKKGGTTPGLQKDVPWRVSTSKPIPKIHHSPILRVSQNPFCDYALSVMKHPNPIGTGLATEALVEAAGPDCIVPGQITPFRVLGLKVWPIEFDLKFMEP
VGRELKLLGKFMDDAVNLMNKSFVDR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G36835 unknown protein Potri.006G122200 0 1
AT4G22720 Actin-like ATPase superfamily ... Potri.007G129400 3.16 0.6563
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Potri.008G054600 21.44 0.6117 HSP70.4
AT5G54880 DTW domain-containing protein ... Potri.001G423900 27.16 0.6100
AT5G27930 Protein phosphatase 2C family ... Potri.013G012200 39.11 0.5710
AT5G46330 FLS2 FLAGELLIN-SENSITIVE 2, Leucine... Potri.004G065400 99.77 0.5323 FLS2.2
AT5G13230 Tetratricopeptide repeat (TPR)... Potri.001G062632 186.08 0.4622

Potri.006G122200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.