Potri.006G122700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03455 218 / 1e-74 ACR2, ARATH;CDC25, CDC25 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021515 220 / 2e-75 AT5G03455 222 / 3e-76 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10022616 218 / 2e-74 AT5G03455 220 / 3e-75 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10023923 196 / 4e-63 AT5G03455 195 / 4e-62 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10014420 196 / 8e-63 AT5G03455 199 / 2e-63 ARSENATE REDUCTASE 2, Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
Representative CDS sequence
>Potri.006G122700.1 pacid=42768719 polypeptide=Potri.006G122700.1.p locus=Potri.006G122700 ID=Potri.006G122700.1.v4.1 annot-version=v4.1
ATGTCTCGTGGCATATCATACATCACAGGGTCTCAACTTCTGTCTCTTAGGCGCCTTCCAAATATTGCAATTATTGATGTCAGGGATGATGAGAGGAGTT
ATGATGGACATATAGCAGGGTCTCTGCACTACGCGAGCGATACGTTCACAGATAGGATCTCTAATCTTATTCAAGAGGTTAAAGGGAAAGATACCCTTGT
TTTCCATTGCGCTTTAAGCCAGGTTCGTGGCCCGACTTGCGCACGAAGGCTTGCCAATTACCTTGAGGAGGTGAAAGAAGATGGAGGAATAAAAAACATT
ATGGTATTGGAACGTGGCTTCAATGGCTGGGAAGCTGCTGGTAGACCTGTTTGTCGCTGCACTGGCATTCCCTGCAAGGATGAAAGTGCTTTGATTTCTG
ATTGA
AA sequence
>Potri.006G122700.1 pacid=42768719 polypeptide=Potri.006G122700.1.p locus=Potri.006G122700 ID=Potri.006G122700.1.v4.1 annot-version=v4.1
MSRGISYITGSQLLSLRRLPNIAIIDVRDDERSYDGHIAGSLHYASDTFTDRISNLIQEVKGKDTLVFHCALSQVRGPTCARRLANYLEEVKEDGGIKNI
MVLERGFNGWEAAGRPVCRCTGIPCKDESALISD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G03455 ACR2, ARATH;CDC... ARSENATE REDUCTASE 2, Rhodanes... Potri.006G122700 0 1
AT2G24940 ATMAPR2 membrane-associated progestero... Potri.018G016900 1.41 0.8365
AT5G64130 cAMP-regulated phosphoprotein ... Potri.017G102700 1.73 0.8391
AT1G48170 unknown protein Potri.008G099700 3.46 0.8034
AT1G45976 SBP1 S-ribonuclease binding protein... Potri.002G124700 3.87 0.8097
AT4G30330 Small nuclear ribonucleoprotei... Potri.018G096200 9.94 0.7775
AT3G16640 TCTP translationally controlled tum... Potri.010G013400 10.48 0.8059 Pt-TCTP.2
Potri.005G241602 11.13 0.8067
AT2G04410 RPM1-interacting protein 4 (RI... Potri.014G168900 11.22 0.7968
Potri.014G055150 15.90 0.7389
AT1G02780 EMB2386 embryo defective 2386, Ribosom... Potri.004G078000 17.29 0.7679 Pt-RPL19.3

Potri.006G122700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.