Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36930 184 / 1e-60 C2H2ZnF zinc finger (C2H2 type) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G093500 [exp] 233 / 5e-81 AT2G36930 184 / 2e-60 zinc finger (C2H2 type) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023928 [exp] 192 / 1e-64 AT2G36930 182 / 1e-59 zinc finger (C2H2 type) family protein (.1) Lus10014426 [exp] 188 / 3e-63 AT2G36930 180 / 7e-59 zinc finger (C2H2 type) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0361 [poplar] [flax] C2H2-zf PF12171 [poplar] [flax] zf-C2H2_jaz Zinc-finger double-stranded RNA-binding
Representative CDS sequence Show only first row Show all	>Potri.006G124100.1 pacid=42770668 polypeptide=Potri.006G124100.1.p locus=Potri.006G124100 ID=Potri.006G124100.1.v4.1 annot-version=v4.1 ATGGGAGGCAAATGTCCAAGCAGGAAGGTGAAGAAGAGAAGATACTCTCACAAGACGGCTCGTCGCTCCAAATTCCTCCTCAAAGCCGACGATGCGGTAT ATGAGGAGCTGCAAAAACCTGATGGAGAGATGAAGTCAATTTTGCCTCTCGACGAGGATTTACCTGGCATGGGCCAATATTACTGTCTCCACTGCGACCG CTACTTTGCTAATGTGACTGTGAGGGATGAGCACTTCAAGACCAAACGCCACAAGAAGCGTGTGAAGCAAATGATGGGACCTGCACCTCATACTCAACTC GATGCTGAGTTAGCTGCTGGAATGGGTGCCCCGGATAATGGTCTTAAGCTTATGTCCATGTGA
AA sequence Show only first row Show all	>Potri.006G124100.1 pacid=42770668 polypeptide=Potri.006G124100.1.p locus=Potri.006G124100 ID=Potri.006G124100.1.v4.1 annot-version=v4.1 MGGKCPSRKVKKRRYSHKTARRSKFLLKADDAVYEELQKPDGEMKSILPLDEDLPGMGQYYCLHCDRYFANVTVRDEHFKTKRHKKRVKQMMGPAPHTQL DAELAAGMGAPDNGLKLMSM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G36930	C2H2ZnF		zinc finger (C2H2 type) family...		Potri.006G124100 [exp]	0	1
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Potri.015G106600 [exp]	2.00	0.7876
AT5G50960		ATNBP35, NBP35	nucleotide binding protein 35 ...		Potri.001G336900 [exp]	7.34	0.7148
AT2G04230			FBD, F-box and Leucine Rich Re...		Potri.004G020200 [exp]	9.16	0.7834
AT3G15352		ATCOX17	ARABIDOPSIS THALIANA CYTOCHROM...		Potri.011G119000 [exp]	10.24	0.7565	ATCOX17.1
AT4G24440			transcription initiation facto...		Potri.005G151700 [exp]	12.00	0.7167
AT5G40370		GRXC2	glutaredoxin C2, Glutaredoxin ...		Potri.001G347700 [exp]	16.49	0.7261	PtrcGrx_C2
AT5G09570			Cox19-like CHCH family protein...		Potri.009G078100 [exp]	17.94	0.7282
AT3G07170			Sterile alpha motif (SAM) doma...		Potri.002G244700 [exp]	18.43	0.7205
AT4G28440			Nucleic acid-binding, OB-fold-...		Potri.007G137600 [exp]	20.12	0.7579
AT5G16790		AtTHO7	Tho complex subunit 7/Mft1p (....		Potri.013G080200 [exp]	21.35	0.7599

Compare expression of checked genes

Potri.006G124100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.