Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) AT2G28085 84 / 8e-22 SAUR-like auxin-responsive protein family (.1) AT4G34760 62 / 1e-13 SAUR-like auxin-responsive protein family (.1) AT2G21220 62 / 3e-13 SAUR-like auxin-responsive protein family (.1) AT3G12830 62 / 4e-13 SAUR-like auxin-responsive protein family (.1) AT2G37030 61 / 6e-13 SAUR-like auxin-responsive protein family (.1) AT4G38860 61 / 7e-13 SAUR-like auxin-responsive protein family (.1) AT1G56150 59 / 2e-12 SAUR-like auxin-responsive protein family (.1) AT2G46690 59 / 6e-12 SAUR-like auxin-responsive protein family (.1) AT2G16580 58 / 8e-12 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G092400 [exp] 220 / 8e-76 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1) Potri.010G226400 [exp] 82 / 3e-21 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 64 / 3e-14 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 64 / 5e-14 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 63 / 7e-14 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.002G176400 [exp] 63 / 1e-13 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 62 / 1e-13 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 64 / 2e-13 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 62 / 2e-13 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004014 [exp] 147 / 1e-46 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1) Lus10030263 [exp] 142 / 1e-44 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1) Lus10013819 [exp] 129 / 2e-39 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1) Lus10026531 [exp] 126 / 2e-38 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1) Lus10001398 [exp] 117 / 2e-34 AT3G09870 97 / 9e-27 SAUR-like auxin-responsive protein family (.1) Lus10023012 [exp] 113 / 3e-33 AT3G09870 97 / 5e-27 SAUR-like auxin-responsive protein family (.1) Lus10021436 [exp] 97 / 2e-26 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1) Lus10016129 [exp] 93 / 4e-25 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1) Lus10001397 [exp] 91 / 2e-24 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1) Lus10021435 [exp] 91 / 3e-24 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.006G125100.1 pacid=42767090 polypeptide=Potri.006G125100.1.p locus=Potri.006G125100 ID=Potri.006G125100.1.v4.1 annot-version=v4.1 ATGAAAAACATGGAAGAAAGCCTTAAAAGAGCAATGATGCTGAAGCTTTTCATAAGAAAGCTGAAGCGGGTTCTCTTACTCTCAGCTTCTAGAGGAGCCA ATGTGCGTGAAACCGGGTTTGATGAAGTGATGGAAGCTGCAAAAATAGTTCCAGTTGATGTAAAGAAGGGACATTTTGCAGTAACTGCGATCAAGGGTGA AGAACCCAAAAGGTTTGTTGTGAAGTTGGATTGCCTCTCTAATCCAGATTTCTTGAGCTTACTAGAGCAGGCTAAAGAGGAATATGGATTTCAACAGGAG GGAGTTCTTGCAGTCCCTTGTCGACCAGAAGAATTACAGATGATTCTAGAAAAAAGGAGAAGGAGAAGGGCAAGCACCGAATGGTAG
AA sequence Show only first row Show all	>Potri.006G125100.1 pacid=42767090 polypeptide=Potri.006G125100.1.p locus=Potri.006G125100 ID=Potri.006G125100.1.v4.1 annot-version=v4.1 MKNMEESLKRAMMLKLFIRKLKRVLLLSASRGANVRETGFDEVMEAAKIVPVDVKKGHFAVTAIKGEEPKRFVVKLDCLSNPDFLSLLEQAKEEYGFQQE GVLAVPCRPEELQMILEKRRRRRASTEW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09870			SAUR-like auxin-responsive pro...		Potri.006G125100 [exp]	0	1
AT5G15310	MYB	ATMYB16, ATMIXT...	myb domain protein 16 (.1.2)		Potri.008G089700 [exp]	6.92	0.9860
AT5G45950			GDSL-like Lipase/Acylhydrolase...		Potri.004G051900 [exp]	8.88	0.9883
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Potri.019G022400 [exp]	10.67	0.9834
AT5G20110			Dynein light chain type 1 fami...		Potri.003G108700 [exp]	11.00	0.9614
AT3G01140	MYB	NOK, ATMYB106	NOECK, myb domain protein 106 ...		Potri.010G165700 [exp]	12.40	0.9865
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.019G008100 [exp]	16.52	0.9805
AT5G27660			Trypsin family protein with PD...		Potri.018G001301 [exp]	17.02	0.9778
AT1G73680		ALPHADOX2 ,ALPH...	alpha dioxygenase (.1.2)		Potri.012G049500 [exp]	18.00	0.9794
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.019G008406 [exp]	19.89	0.9853
AT3G60510			ATP-dependent caseinolytic (Cl...		Potri.001G156900 [exp]	21.09	0.9850

Compare expression of checked genes

Potri.006G125100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.