Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ROT4.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36985 75 / 4e-20 DVL16, ROT4 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) AT3G53232 54 / 1e-11 RTFL1, DVL20 DEVIL 20, ROTUNDIFOLIA like 1 (.1) AT3G55515 50 / 5e-10 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT1G07490 50 / 7e-10 RTFL3, DVL9 DEVIL 9, ROTUNDIFOLIA like 3 (.1) AT2G39705 49 / 9e-10 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1) AT4G13395 47 / 3e-09 DVL10, RTFL12 DEVIL 10, ROTUNDIFOLIA like 12 (.1) AT2G29125 48 / 7e-09 RTFL2, DVL13 DEVIL 13, ROTUNDIFOLIA like 2 (.1) AT1G53708 46 / 4e-08 RTFL9 ROTUNDIFOLIA like 9 (.1) AT3G14362 42 / 2e-07 DVL19, RTFL10 DEVIL 19, ROTUNDIFOLIA like 10 (.1) AT1G67265 42 / 2e-07 DVL3, RTFL21 DEVIL 3, ROTUNDIFOLIA like 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G226250 [exp] 67 / 4e-17 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.008G035900 [exp] 66 / 2e-16 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G201700 [exp] 53 / 2e-11 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.008G057800 [exp] 52 / 6e-11 AT2G39705 84 / 8e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.001G242800 [exp] 51 / 2e-10 AT2G29125 71 / 4e-17 DEVIL 13, ROTUNDIFOLIA like 2 (.1) Potri.001G161200 [exp] 47 / 5e-09 AT1G53708 76 / 1e-19 ROTUNDIFOLIA like 9 (.1) Potri.003G073900 [exp] 45 / 2e-08 AT1G53708 81 / 9e-22 ROTUNDIFOLIA like 9 (.1) Potri.002G235101 [exp] 44 / 8e-08 AT1G53708 75 / 1e-19 ROTUNDIFOLIA like 9 (.1) Potri.009G034300 [exp] 43 / 3e-07 AT2G29125 64 / 9e-15 DEVIL 13, ROTUNDIFOLIA like 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026526 [exp] 68 / 4e-17 AT2G36985 63 / 2e-15 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Lus10002705 [exp] 52 / 8e-11 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10023399 [exp] 52 / 1e-10 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10040784 [exp] 52 / 2e-10 AT5G59510 84 / 1e-21 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10001569 [exp] 47 / 2e-08 AT5G59510 79 / 8e-20 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10021966 [exp] 45 / 4e-08 AT1G53708 73 / 8e-19 ROTUNDIFOLIA like 9 (.1) Lus10041259 [exp] 45 / 5e-08 AT1G53708 70 / 2e-17 ROTUNDIFOLIA like 9 (.1) Lus10034272 [exp] 41 / 1e-06 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10028393 [exp] 41 / 1e-06 AT4G35783 60 / 5e-14 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10041491 [exp] 40 / 3e-06 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [poplar] [flax] DVL DVL family
Representative CDS sequence Show only first row Show all	>Potri.006G125600.1 pacid=42769951 polypeptide=Potri.006G125600.1.p locus=Potri.006G125600 ID=Potri.006G125600.1.v4.1 annot-version=v4.1 ATGGCAGGCAAGGAAAAGAGTGAGACTCAGCTGCATGGTTGTGAACCCTGCAGATCGTTTGGGCAGAAGTGCAGCCATTTGGTGAAGAAGCAGAGGGGCA AATTCTATATCGTCAGGCGTTGCATAGCCATGCTTATTTGCTGGCATGAGCGTGAGCGCGGCGAGCCTTGA
AA sequence Show only first row Show all	>Potri.006G125600.1 pacid=42769951 polypeptide=Potri.006G125600.1.p locus=Potri.006G125600 ID=Potri.006G125600.1.v4.1 annot-version=v4.1 MAGKEKSETQLHGCEPCRSFGQKCSHLVKKQRGKFYIVRRCIAMLICWHERERGEP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G36985		DVL16, ROT4	ROTUNDIFOLIA4, DEVIL 16, DVL f...		Potri.006G125600 [exp]	0	1	Pt-ROT4.1
					Potri.012G031250 [exp]	1.73	0.9532
AT5G43250	CCAAT	NF-YC13	"nuclear factor Y, subunit C13...		Potri.001G055000 [exp]	4.47	0.9304
AT4G39010		ATGH9B18	glycosyl hydrolase 9B18 (.1)		Potri.004G162200 [exp]	4.47	0.9502
AT4G13440			Calcium-binding EF-hand family...		Potri.019G029100 [exp]	5.47	0.9262
					Potri.010G190900 [exp]	5.74	0.9098
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Potri.016G098600 [exp]	6.00	0.9144	XTH32.2
AT1G12350		ATCOAB	4-phospho-panto-thenoylcystein...		Potri.005G170600 [exp]	7.74	0.8761
AT2G44930			Plant protein of unknown funct...		Potri.017G019400 [exp]	9.64	0.8744
AT4G14380			unknown protein		Potri.008G167200 [exp]	11.40	0.9129
AT3G48770			DNA binding;ATP binding (.1)		Potri.015G102301 [exp]	20.19	0.9458

Compare expression of checked genes

Potri.006G125600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.