Potri.006G125900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03330 329 / 9e-112 Cysteine proteinases superfamily protein (.1.2)
AT5G04250 276 / 3e-91 Cysteine proteinases superfamily protein (.1.2)
AT3G02070 238 / 6e-78 Cysteine proteinases superfamily protein (.1)
AT3G22260 213 / 8e-68 Cysteine proteinases superfamily protein (.1.2.3)
AT2G39320 97 / 5e-24 Cysteine proteinases superfamily protein (.1)
AT5G67170 62 / 2e-10 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 52 / 4e-07 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G094700 608 / 0 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.010G225400 313 / 4e-105 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036700 302 / 9e-101 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2)
Potri.016G019700 238 / 1e-77 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G021700 235 / 1e-76 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 234 / 3e-76 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.008G036900 222 / 3e-72 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.005G140500 62 / 1e-10 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.004G196800 51 / 8e-07 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001404 393 / 1e-136 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 381 / 6e-132 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10026525 355 / 1e-121 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10013813 348 / 3e-119 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10038708 285 / 4e-94 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 282 / 5e-93 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10037388 271 / 3e-89 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
Lus10010459 223 / 1e-71 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027312 210 / 5e-66 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10003816 190 / 4e-59 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.006G125900.1 pacid=42770470 polypeptide=Potri.006G125900.1.p locus=Potri.006G125900 ID=Potri.006G125900.1.v4.1 annot-version=v4.1
ATGGTTATTTACGAGCAAGAGTCGGATGTTATTCAATGGGGTCTTCGTCTTCTTGATGGGGACCCACCCTTTTATTCTGGGTACTATGGTGAAGCAATAG
TACAGAGTGATGATGGATACCATGGACATTATGTGAGGGATCATTATGATATTACGGACTGTAGCCATGTAGAGAATGATGAGATGATTGCACGCACGTT
GCAAGAAGAGTTTTCGCAGCTTGCAGTTACTGAAGAAAATGGGTATTCACATGGTGGAGAAGAGCTTTCAGTTACTGAAGAAAATGTGTATTCACATGGT
GGAGAAGAGCATTTGCAGACTTCTGTTGATGAGCATGATTGGCATTGTACACCGATGAGGAACTACCGTTCAGACAATGAGTGTAGTCATGAAGAATCAG
ATGATGCAGTACCCTCTAGTTCATGCTCAAGTCCTGCTAATGGAGAAGAGTATTCCTATTCACCAGAGTTTACTGATGAAGATGGCCTGGATGATGAAGT
AGGCAAGAGGTTGAATCAGTTGATTCCAATCCGTCATGTTCCAAGAATTAATGGAGAAATACCTTCAATTGATGAAGCAACATCAGATCATGAAAGGCTT
CTGAACAGACTGCAGTTATTTGGCTTTGAAGAGCTCAAGGTTCCAGGGGATGGAAACTGTCAGTTCCGTGCTTTATCAGATCAAATATATAATACACCTG
ATCGCCACAAAATAGTAAGACGACAGGTTGTGTATCAGCTTAAATCTCACCCAGAGATATACGAGGGATATGTTCCCATGGAGTATGGTGACTATTTGAG
GAAGATGTCGAAGAGTGGTGAGTGGGGTGATCATGTGACATTGCAGGCAGTTGCGGATGCGTATGGCGTGAAAATACTCGTCATGACTTCTTTCAAGGAC
ACATGTTACATAGAGATTCTTCCTGTCAGCCAAAAGCCAAAAGGAGTCATTTTCTTGAGCTTTTGGGCAGAGGTACACTACAACTCCATCTATTTTCAAG
GAGATACATCTAGTGAATTCAGAAAGAAGAAAAGGTGGTGGAATTTCGGGAATAAGAACTAG
AA sequence
>Potri.006G125900.1 pacid=42770470 polypeptide=Potri.006G125900.1.p locus=Potri.006G125900 ID=Potri.006G125900.1.v4.1 annot-version=v4.1
MVIYEQESDVIQWGLRLLDGDPPFYSGYYGEAIVQSDDGYHGHYVRDHYDITDCSHVENDEMIARTLQEEFSQLAVTEENGYSHGGEELSVTEENVYSHG
GEEHLQTSVDEHDWHCTPMRNYRSDNECSHEESDDAVPSSSCSSPANGEEYSYSPEFTDEDGLDDEVGKRLNQLIPIRHVPRINGEIPSIDEATSDHERL
LNRLQLFGFEELKVPGDGNCQFRALSDQIYNTPDRHKIVRRQVVYQLKSHPEIYEGYVPMEYGDYLRKMSKSGEWGDHVTLQAVADAYGVKILVMTSFKD
TCYIEILPVSQKPKGVIFLSFWAEVHYNSIYFQGDTSSEFRKKKRWWNFGNKN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G03330 Cysteine proteinases superfami... Potri.006G125900 0 1
AT2G18250 ATCOAD 4-phosphopantetheine adenylylt... Potri.005G121200 11.40 0.7755
AT2G40270 Protein kinase family protein ... Potri.009G075400 16.40 0.7877
AT5G04460 RING/U-box superfamily protein... Potri.010G231100 19.49 0.7276
AT4G15920 SWEET17, AtSWEE... Nodulin MtN3 family protein (.... Potri.013G013800 27.56 0.7480
Potri.001G375600 28.24 0.7107
AT2G46550 unknown protein Potri.014G100300 36.87 0.7321
Potri.003G038525 42.53 0.7543
AT1G10170 ATNFXL1 NF-X-like 1 (.1) Potri.015G034500 46.58 0.7123
AT3G47890 Ubiquitin carboxyl-terminal hy... Potri.012G071900 52.76 0.6810
AT1G20670 DNA-binding bromodomain-contai... Potri.002G009100 54.79 0.6886 BRD901

Potri.006G125900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.