Plant FIBer expression Database

Potri.006G126750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G473250
[exp]
165 / 3e-54 ND /
Potri.018G060100
[exp]
161 / 1e-52 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.006G126750.1 pacid=42769747 polypeptide=Potri.006G126750.1.p locus=Potri.006G126750 ID=Potri.006G126750.1.v4.1 annot-version=v4.1
ATGATGAAAGCAAAAGTAAATACAATATCATGTTCAACAGACTTGATTGAAGGCTCTAAAAAAGCTAATATAATGCTTCATAATGAAACAAGATTTATTA
TTGATAATGTTTTGTTCTTTACTAAATCAATGAGAAATCTACTAAATTTCAAAGACATACGACTTAACAAGTATCATATTGAGACTGTCAATGACAATGA
TATAGAATATCTTTACATCGTATCAAATGTCTCTACTGGAAAACAAATATTAGAAAAATTATTCGTTTTATCTTTAGGTTTGTACTACACAAGTTTTGGT
ACAATCGAAGTCAATGCAATAATGAACCAGAAGTTCAATAAACCAACTAATTTTATTATTTGGCATGAC
AA sequence
>Potri.006G126750.1 pacid=42769747 polypeptide=Potri.006G126750.1.p locus=Potri.006G126750 ID=Potri.006G126750.1.v4.1 annot-version=v4.1
MMKAKVNTISCSTDLIEGSKKANIMLHNETRFIIDNVLFFTKSMRNLLNFKDIRLNKYHIETVNDNDIEYLYIVSNVSTGKQILEKLFVLSLGLYYTSFG
TIEVNAIMNQKFNKPTNFIIWHD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G126750
[exp]
0 1
AT1G03220 Eukaryotic aspartyl protease f... Potri.005G095600
[exp]
13.07 0.6395
AT5G59030 COPT1 copper transporter 1 (.1) Potri.001G246000
[exp]
14.10 0.6805
AT1G76210 Arabidopsis protein of unknown... Potri.005G248700
[exp]
19.44 0.5876
Potri.001G372750
[exp]
20.14 0.5596
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Potri.011G077380
[exp]
23.32 0.5935
AT2G46570 LAC6 laccase 6 (.1) Potri.014G100600
[exp]
30.33 0.6145
AT5G07050 nodulin MtN21 /EamA-like trans... Potri.012G007700
[exp]
39.98 0.5970
AT1G68510 AS2 LBD42 LOB domain-containing protein ... Potri.008G120600
[exp]
45.03 0.5813
AT4G16295 SPH1 S-protein homologue 1 (.1) Potri.004G199700
[exp]
46.58 0.5568
AT5G66390 Peroxidase superfamily protein... Potri.007G019300
[exp]
47.95 0.5906

Potri.006G126750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.