Potri.006G127750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026509 50 / 6e-10 ND /
Lus10019938 39 / 5e-05 ND /
PFAM info
Representative CDS sequence
>Potri.006G127750.1 pacid=42768499 polypeptide=Potri.006G127750.1.p locus=Potri.006G127750 ID=Potri.006G127750.1.v4.1 annot-version=v4.1
ATGGCAACGCCTAAGGAAGATGAAAGAAGGCTTTATCAATGTGCAAGAAAGTATGAAAAAATTGTAAAACAGCTGAGTGAGATGATGAACACCAGAACCA
GACTGCCAAAGCGACGACGAGTATCCTCAACTATAACAAAATTTCTCAACGAAATGCGGGCTAACCCTTCAACAGATACTGATGGCTCTGCAAGTACAAG
AGAAAGAGATCCAGAATAG
AA sequence
>Potri.006G127750.1 pacid=42768499 polypeptide=Potri.006G127750.1.p locus=Potri.006G127750 ID=Potri.006G127750.1.v4.1 annot-version=v4.1
MATPKEDERRLYQCARKYEKIVKQLSEMMNTRTRLPKRRRVSSTITKFLNEMRANPSTDTDGSASTRERDPE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G127750 0 1
AT4G10260 pfkB-like carbohydrate kinase ... Potri.019G063600 8.00 0.9630
Potri.012G026150 11.74 0.9596
AT5G19760 Mitochondrial substrate carrie... Potri.001G004366 12.64 0.9612
Potri.019G014330 19.05 0.9514
Potri.008G069050 19.89 0.9477
AT3G23770 O-Glycosyl hydrolases family 1... Potri.001G321900 20.00 0.9465 A6.1
AT1G26820 RNS3 ribonuclease 3 (.1) Potri.010G168600 20.49 0.8215 S.1
Potri.006G195500 21.16 0.9468
AT1G67950 RNA-binding (RRM/RBD/RNP motif... Potri.010G103600 23.23 0.9447
AT5G20635 AGG3 Arabidopsis G protein gamma su... Potri.018G062400 23.68 0.9103

Potri.006G127750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.