Potri.006G128300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G089400 42 / 1e-07 ND /
Potri.006G128250 37 / 3e-05 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.006G128300.1 pacid=42769314 polypeptide=Potri.006G128300.1.p locus=Potri.006G128300 ID=Potri.006G128300.1.v4.1 annot-version=v4.1
ATGGCTAAGGAGGTTAGCGGTTCACGTTCTTGGATTGAGGTGGCTCCAGCTCCAATCATTTATCCCCGGAAGCCTTCAAATGCTCCCCGTTTGGAGCCGA
TAGCCGAAGAGGGCCACGAGGAACATGATGAAGATTCACAAGCCTTCCAGTAA
AA sequence
>Potri.006G128300.1 pacid=42769314 polypeptide=Potri.006G128300.1.p locus=Potri.006G128300 ID=Potri.006G128300.1.v4.1 annot-version=v4.1
MAKEVSGSRSWIEVAPAPIIYPRKPSNAPRLEPIAEEGHEEHDEDSQAFQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G128300 0 1
AT5G05800 unknown protein Potri.001G339400 3.00 0.9959
AT5G05800 unknown protein Potri.007G118701 5.29 0.9938
AT3G61230 LIM PLIM2c PLIM2c, GATA type zinc finger ... Potri.001G107100 10.24 0.9878
AT1G02090 ATCSN7, COP15, ... FUSCA 5, CONSTITUTIVE PHOTOMOR... Potri.003G081066 12.40 0.9909
AT3G22930 CML11 calmodulin-like 11 (.1) Potri.002G047300 14.49 0.9847 Pt-ACCAL.7
Potri.013G071200 16.61 0.9908
AT5G05800 unknown protein Potri.014G061450 17.20 0.9917
Potri.009G020201 18.24 0.9917
AT3G09925 Pollen Ole e 1 allergen and ex... Potri.006G119100 21.16 0.9778
AT1G80530 Major facilitator superfamily ... Potri.006G060900 21.90 0.9640

Potri.006G128300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.