Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09780 87 / 2e-21 CCR1, ATCRR1 CRINKLY4 related 1 (.1) AT2G39180 84 / 2e-20 CCR2, ATCRR2 CRINKLY4 related 2 (.1) AT3G28690 72 / 2e-16 Protein kinase superfamily protein (.1.2.3) AT3G55950 71 / 1e-15 CCR3, ATCRR3 CRINKLY4 related 3 (.1) AT3G01300 70 / 2e-15 Protein kinase superfamily protein (.1) AT3G24790 69 / 5e-15 Protein kinase superfamily protein (.1) AT5G15080 69 / 7e-15 Protein kinase superfamily protein (.1) AT3G58690 66 / 4e-14 Protein kinase superfamily protein (.1) AT2G26290 66 / 5e-14 ARSK1 root-specific kinase 1 (.1) AT2G25220 66 / 5e-14 Protein kinase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G089200 [exp] 117 / 5e-32 AT3G09780 946 / 0.0 CRINKLY4 related 1 (.1) Potri.010G221200 [exp] 92 / 6e-23 AT2G39180 899 / 0.0 CRINKLY4 related 2 (.1) Potri.004G129000 [exp] 73 / 2e-16 AT5G15080 659 / 0.0 Protein kinase superfamily protein (.1) Potri.008G194700 [exp] 71 / 1e-15 AT5G15080 671 / 0.0 Protein kinase superfamily protein (.1) Potri.019G078300 [exp] 70 / 2e-15 AT5G47850 699 / 0.0 CRINKLY4 related 4 (.1) Potri.013G103300 [exp] 70 / 3e-15 AT5G47850 649 / 0.0 CRINKLY4 related 4 (.1) Potri.010G033800 [exp] 69 / 3e-15 AT5G15080 669 / 0.0 Protein kinase superfamily protein (.1) Potri.004G123800 [exp] 69 / 6e-15 AT5G15080 694 / 0.0 Protein kinase superfamily protein (.1) Potri.001G252400 [exp] 69 / 8e-15 AT3G55950 692 / 0.0 CRINKLY4 related 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041404 [exp] 80 / 7e-19 AT2G39180 849 / 0.0 CRINKLY4 related 2 (.1) Lus10036524 [exp] 79 / 1e-18 AT2G39180 848 / 0.0 CRINKLY4 related 2 (.1) Lus10005255 [exp] 71 / 2e-15 AT5G15080 720 / 0.0 Protein kinase superfamily protein (.1) Lus10030668 [exp] 71 / 2e-15 AT5G15080 723 / 0.0 Protein kinase superfamily protein (.1) Lus10018242 [exp] 70 / 2e-15 AT3G55950 632 / 0.0 CRINKLY4 related 3 (.1) Lus10011866 [exp] 70 / 3e-15 AT3G07070 556 / 0.0 Protein kinase superfamily protein (.1) Lus10040663 [exp] 70 / 3e-15 AT3G55950 642 / 0.0 CRINKLY4 related 3 (.1) Lus10013273 [exp] 69 / 7e-15 AT3G17900 696 / 0.0 unknown protein Lus10007232 [exp] 67 / 3e-14 AT1G09970 1186 / 0.0 receptor-like kinase 7, Leucine-rich receptor-like protein kinase family protein (.1.2) Lus10030796 [exp] 67 / 4e-14 AT5G15080 691 / 0.0 Protein kinase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.006G128400.1 pacid=42767974 polypeptide=Potri.006G128400.1.p locus=Potri.006G128400 ID=Potri.006G128400.1.v4.1 annot-version=v4.1 ATGCATATGCCCCATGGCACGCTTCATGATCATCTCCATAGTGGGCTTTCTTCTCTGAATTGGAGCCTTAGGTTGAAGATTTTAATGCGGGCTGCAAAAG GACTTGAGTACCTTCACAAGGAAGCTGAACAACCAATTGTCTATCACAATGTCAAGACTTCGAACTTTCTTTTGGATTCTGCCTGGGGAGCACGAATAGC AGATTTTGGGCTTCTTTCAGCAAATGAAAAGGATCTTGGTGGAGACATGAAAAGATGTATACAATTTTGGAACTGTACTGCTAGAGATTCTTAG
AA sequence Show only first row Show all	>Potri.006G128400.1 pacid=42767974 polypeptide=Potri.006G128400.1.p locus=Potri.006G128400 ID=Potri.006G128400.1.v4.1 annot-version=v4.1 MHMPHGTLHDHLHSGLSSLNWSLRLKILMRAAKGLEYLHKEAEQPIVYHNVKTSNFLLDSAWGARIADFGLLSANEKDLGGDMKRCIQFWNCTARDS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09780		CCR1, ATCRR1	CRINKLY4 related 1 (.1)		Potri.006G128400 [exp]	0	1
AT1G69480			EXS (ERD1/XPR1/SYG1) family pr...		Potri.010G165400 [exp]	4.00	0.8312
AT2G41430		LSR1, CID1, ERD...	CTC-Interacting Domain 1, dehy...		Potri.003G202500 [exp]	9.38	0.7734
AT1G31280		AGO2	argonaute 2, Argonaute family ...		Potri.015G117350 [exp]	10.58	0.7651
AT5G66360		DIM1B	adenosine dimethyl transferase...		Potri.006G264101 [exp]	13.41	0.7961
AT2G05755			Nodulin MtN21 /EamA-like trans...		Potri.014G157700 [exp]	21.97	0.7461
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.001G441801 [exp]	22.62	0.7357
AT5G61580		PFK4	phosphofructokinase 4 (.1.2)		Potri.001G079501 [exp]	26.32	0.7488
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Potri.014G041532 [exp]	35.49	0.6985
AT2G45400		BEN1	NAD(P)-binding Rossmann-fold s...		Potri.002G147702 [exp]	39.74	0.7053
AT1G75720			Plant protein of unknown funct...		Potri.019G021000 [exp]	42.42	0.7649

Compare expression of checked genes

Potri.006G128400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.