Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR6
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20820 136 / 2e-42 SAUR-like auxin-responsive protein family (.1) AT1G72430 106 / 7e-31 SAUR-like auxin-responsive protein family (.1) AT1G17345 106 / 1e-30 SAUR-like auxin-responsive protein family (.1) AT3G12955 65 / 3e-14 SAUR-like auxin-responsive protein family (.1) AT3G12830 54 / 5e-10 SAUR-like auxin-responsive protein family (.1) AT1G56150 46 / 2e-07 SAUR-like auxin-responsive protein family (.1) AT3G43120 47 / 3e-07 SAUR-like auxin-responsive protein family (.1) AT1G16510 45 / 9e-07 SAUR-like auxin-responsive protein family (.1) AT5G20810 44 / 3e-06 SAUR-like auxin-responsive protein family (.1.2) AT4G34750 44 / 5e-06 SAUR-like auxin-responsive protein family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G071000 [exp] 114 / 7e-34 AT1G72430 126 / 9e-39 SAUR-like auxin-responsive protein family (.1) Potri.001G164300 [exp] 97 / 8e-27 AT1G72430 108 / 2e-31 SAUR-like auxin-responsive protein family (.1) Potri.011G143400 [exp] 77 / 3e-19 AT3G12955 91 / 2e-24 SAUR-like auxin-responsive protein family (.1) Potri.001G458000 [exp] 77 / 7e-19 AT3G12955 86 / 3e-22 SAUR-like auxin-responsive protein family (.1) Potri.006G211000 [exp] 44 / 3e-06 AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 43 / 3e-06 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 42 / 6e-06 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.005G096400 [exp] 42 / 1e-05 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 42 / 1e-05 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013181 [exp] 106 / 2e-30 AT1G72430 119 / 9e-36 SAUR-like auxin-responsive protein family (.1) Lus10037443 [exp] 102 / 8e-29 AT1G72430 114 / 1e-33 SAUR-like auxin-responsive protein family (.1) Lus10031790 [exp] 67 / 7e-15 AT3G12955 98 / 8e-27 SAUR-like auxin-responsive protein family (.1) Lus10017018 [exp] 49 / 5e-08 AT2G36210 124 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10021341 [exp] 47 / 3e-07 AT2G36210 123 / 4e-37 SAUR-like auxin-responsive protein family (.1) Lus10031178 [exp] 43 / 1e-05 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 40 / 6e-05 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10031754 [exp] 40 / 9e-05 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1) Lus10034888 [exp] 40 / 0.0001 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2) Lus10007553 [exp] 39 / 0.0001 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.006G137000.1 pacid=42769001 polypeptide=Potri.006G137000.1.p locus=Potri.006G137000 ID=Potri.006G137000.1.v4.1 annot-version=v4.1 ATGGCCAAAGGAGGCAAGCTCATGAGGCTCAAGTCGGTCCTCAAGAAACTCAACTCCTTCAACAACAACAAGCAAAGCCGCCCCAGTAAGATTGGAAGCT CCATATCTGTCACCAACGATGACATCTCCTCCTCCTACTCCTCCGGTGATCTCCACCCCGTCTACGTAGGAAAATCTCGTCGACGCTATCTCATAAGCTC CGATATCATTGACCATCCACTGTTTCGTGAGCTTGCAGAGAGGTCTAGTACTGAGCAATCCCCTGATACTATTAATGTTGCATGTGAGGTGGTTTTGTTC GAGCACTTGCTTTGGATGTTGGAGAATGCTGACCCACAGCCTGAGTCTCTTGACGAGCTCGTTGAATTCTATGCTTGTTGA
AA sequence Show only first row Show all	>Potri.006G137000.1 pacid=42769001 polypeptide=Potri.006G137000.1.p locus=Potri.006G137000 ID=Potri.006G137000.1.v4.1 annot-version=v4.1 MAKGGKLMRLKSVLKKLNSFNNNKQSRPSKIGSSISVTNDDISSSYSSGDLHPVYVGKSRRRYLISSDIIDHPLFRELAERSSTEQSPDTINVACEVVLF EHLLWMLENADPQPESLDELVEFYAC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20820			SAUR-like auxin-responsive pro...		Potri.006G137000 [exp]	0	1	SAUR6
AT5G44680			DNA glycosylase superfamily pr...		Potri.008G081000 [exp]	1.00	0.8447
AT5G66590			CAP (Cysteine-rich secretory p...		Potri.007G033200 [exp]	2.00	0.7647
AT1G53700		PK3AT, WAG1	PROTEIN KINASE 3 ARABIDOPSIS T...		Potri.011G139800 [exp]	2.00	0.8080	Pt-PSPK3.2
AT4G14750		IQD19	IQ-domain 19 (.1)		Potri.010G082600 [exp]	7.00	0.7152
AT2G40475		ASG8	ALTERED SEED GERMINATION 8, un...		Potri.006G107200 [exp]	9.74	0.7371
AT4G34770			SAUR-like auxin-responsive pro...		Potri.004G165800 [exp]	12.48	0.6866
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Potri.003G150600 [exp]	13.11	0.6132
AT5G66390			Peroxidase superfamily protein...		Potri.005G118700 [exp]	14.07	0.7183
AT1G55740		RS1, ATSIP1	raffinose synthase 1, seed imb...		Potri.011G166700 [exp]	16.12	0.6374	AGA1.1
AT1G72930		TIR	toll/interleukin-1 receptor-li...		Potri.005G004366 [exp]	16.88	0.6468

Compare expression of checked genes

Potri.006G137000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.