Pt-PRXQ.1 (Potri.006G137500) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-PRXQ.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26060 286 / 7e-99 ATPRXQ ,ATPRX Q peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
AT5G06290 79 / 1e-17 2CPB, 2-CysPrxB ,2-Cys Prx B 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
AT3G11630 76 / 1e-16 Thioredoxin superfamily protein (.1)
AT1G48130 50 / 2e-07 ATPER1 1-cysteine peroxiredoxin 1 (.1)
AT4G31870 40 / 0.0007 ATGPX7 glutathione peroxidase 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G063300 328 / 2e-115 AT3G26060 275 / 1e-94 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Potri.006G204900 80 / 7e-18 AT5G06290 385 / 2e-136 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Potri.016G072100 76 / 2e-16 AT5G06290 390 / 3e-138 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Potri.008G099900 43 / 6e-05 AT1G48130 322 / 2e-111 1-cysteine peroxiredoxin 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034892 298 / 6e-104 AT3G26060 281 / 6e-97 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Lus10033424 293 / 1e-101 AT3G26060 278 / 1e-95 peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Lus10021295 79 / 9e-18 AT5G06290 404 / 6e-144 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Lus10016969 79 / 1e-17 AT5G06290 403 / 2e-143 2-CYS PEROXIREDOXIN B, 2-cysteine peroxiredoxin B (.1)
Lus10018342 45 / 1e-05 AT1G48130 338 / 2e-119 1-cysteine peroxiredoxin 1 (.1)
Lus10017112 43 / 7e-05 AT1G48130 335 / 3e-118 1-cysteine peroxiredoxin 1 (.1)
Lus10026887 42 / 0.0002 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1)
Lus10003421 42 / 0.0002 AT4G31870 319 / 9e-110 glutathione peroxidase 7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF08534 Redoxin Redoxin
Representative CDS sequence
>Potri.006G137500.1 pacid=42766979 polypeptide=Potri.006G137500.1.p locus=Potri.006G137500 ID=Potri.006G137500.1.v4.1 annot-version=v4.1
ATGGCTTCCATTTCTCTCCCTAAACACTCTCTGCCCTCTTTGCTTCCCACTCTTAAACCCATAACCTCATCTTCTCAAAACCTCCCAATTCTCTCCAAGT
CATCGCAGTCACAGTTCTATGGCCTCAAGTTCTCCCATTCTACTTCTCTTTCAATCCCATCTTCTTCTTCGGTGAAGAATACCATTTTTGCCAAGGTAAA
CAAAGGACAGGCGCCACCATCCTTCACTTTGAAAGATCAGGATGGAAAGACTTTGTCCCTCTCCAAATTCAAAGGGAAGCCTGTGGTTGTCTACTTTTAC
CCTGCTGATGAAACCCCTGGGTGCACCAAACAGGCCTGTGCTTTTAGAGATTCTTATGAGAAGTTCAAGAAAGCAGGCGCTGAGGTTGTTGGAATTAGTG
GTGATGATCCATCATCGCACAAGGCATTTTCCAAAAAATACAGACTTCCATTTACATTGCTGAGCGACGAAGGTAACAAGATAAGGAAAGAGTGGGGAGT
GCCAGCAGACCTGTTCGGGACCTTACCTGGGAGACAGACATATGTTCTGGACAAGAAAGGGGTGGTCCAACTCATCTACAACAATCAGTTCCAACCTGAA
AAGCATATTGATGAAACTCTTAAACTACTTCAAAGCCTTTGA
AA sequence
>Potri.006G137500.1 pacid=42766979 polypeptide=Potri.006G137500.1.p locus=Potri.006G137500 ID=Potri.006G137500.1.v4.1 annot-version=v4.1
MASISLPKHSLPSLLPTLKPITSSSQNLPILSKSSQSQFYGLKFSHSTSLSIPSSSSVKNTIFAKVNKGQAPPSFTLKDQDGKTLSLSKFKGKPVVVYFY
PADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDPSSHKAFSKKYRLPFTLLSDEGNKIRKEWGVPADLFGTLPGRQTYVLDKKGVVQLIYNNQFQPE
KHIDETLKLLQSL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G26060 ATPRXQ ,ATPRX Q peroxiredoxin Q, Thioredoxin s... Potri.006G137500 0 1 Pt-PRXQ.1
AT3G01500 SABP3, ATBCA1, ... ARABIDOPSIS THALIANA SALICYLIC... Potri.001G348900 1.00 0.9843 CA1.3
AT2G24270 ALDH11A3 aldehyde dehydrogenase 11A3 (.... Potri.018G109700 2.00 0.9797 Pt-ALDH11.1
AT2G39730 RCA rubisco activase (.1.2.3) Potri.010G200500 5.29 0.9571
AT1G67090 RBCS1A ribulose bisphosphate carboxyl... Potri.004G100000 5.29 0.9631
AT1G56190 Phosphoglycerate kinase family... Potri.008G084500 5.74 0.9730
AT4G39230 NmrA-like negative transcripti... Potri.013G104000 7.74 0.9676
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Potri.005G063300 8.24 0.9718
AT2G25080 ATGPX1 glutathione peroxidase 1 (.1) Potri.018G017500 9.48 0.9456
AT1G42970 GAPB glyceraldehyde-3-phosphate deh... Potri.002G007100 10.39 0.9619
AT1G32080 AtLrgB membrane protein, putative (.1... Potri.003G099600 10.95 0.9589

Potri.006G137500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.