Potri.006G137800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20740 205 / 2e-67 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 139 / 3e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 129 / 1e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 127 / 7e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 120 / 5e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 116 / 1e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 114 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 116 / 2e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 109 / 1e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G23205 108 / 2e-29 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G127500 134 / 2e-39 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 132 / 7e-39 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 127 / 5e-37 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 127 / 6e-37 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.014G129400 123 / 3e-35 AT3G62820 163 / 6e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 122 / 5e-35 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.008G132600 121 / 2e-34 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G109300 116 / 2e-32 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 115 / 3e-32 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031133 135 / 5e-40 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 135 / 7e-40 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 128 / 3e-37 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 124 / 9e-36 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 124 / 2e-35 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10032230 120 / 8e-34 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031132 109 / 6e-30 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10024593 107 / 5e-29 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038645 107 / 9e-29 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 104 / 6e-28 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.006G137800.1 pacid=42769255 polypeptide=Potri.006G137800.1.p locus=Potri.006G137800 ID=Potri.006G137800.1.v4.1 annot-version=v4.1
ATGAAAGAGTTAGAAACAATGTCTCCCCCTTTCTCTCTCTTTAACCTTCTCTTCATCTTCATTTCCTTCTCCACATCTCCTTACTCCGCCGCTGCAAAGT
CCCACAATGCACCGCGAGATCTAGTCCGTTCATCCTGCGTCCACGCTAGTTACCCTAACCTCTGCCTCCGCACTCTTTCCTCTTATGCAGGCCCTGCCAA
CACCCCACGTGACCTGGCCCAAGCAGCTGTCAAGGTAAGCATTGCACGTGCCAGGAAAGTGTCAAACTACCTGAGCACACTCTCGGGTCTTAAGAAAAAG
AGAGAGCGAGTTGCACTGAGTGATTGTATTGAGCAGATATATGACTCGGTGGATGAGCTGAGCAAGACACTGGGTGAGTTGAAGCATTTGAGAGAGGAAA
CGTTTGGGTGGCAGATGAGTAATGCACAGACATGGGTCAGCGCTGCTTTGACTAACGAGGACACGTGTCTTGATGGGTTTCACGAAGTTGAAAGCAAAGC
CAAGGATGATGTGAAGAGAAAGATCACTAATGTTGCTAGGGTTACTAGTAATGCTTTGTACATGATTAATCGTCTTGATGAAAGTCGTGGGAGGCCAAAG
CTGGGACGTCATTGA
AA sequence
>Potri.006G137800.1 pacid=42769255 polypeptide=Potri.006G137800.1.p locus=Potri.006G137800 ID=Potri.006G137800.1.v4.1 annot-version=v4.1
MKELETMSPPFSLFNLLFIFISFSTSPYSAAAKSHNAPRDLVRSSCVHASYPNLCLRTLSSYAGPANTPRDLAQAAVKVSIARARKVSNYLSTLSGLKKK
RERVALSDCIEQIYDSVDELSKTLGELKHLREETFGWQMSNAQTWVSAALTNEDTCLDGFHEVESKAKDDVKRKITNVARVTSNALYMINRLDESRGRPK
LGRH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G20740 Plant invertase/pectin methyle... Potri.006G137800 0 1
AT4G24340 Phosphorylase superfamily prot... Potri.013G082066 1.73 0.9993
AT1G56170 CCAAT NF-YC2, ATHAP5B... "nuclear factor Y, subunit C2"... Potri.017G120000 2.44 0.9980
AT5G40990 GLIP1 GDSL lipase 1 (.1) Potri.004G084500 3.74 0.9878
AT4G24340 Phosphorylase superfamily prot... Potri.013G082800 3.87 0.9985
AT5G33370 GDSL-like Lipase/Acylhydrolase... Potri.019G024700 4.47 0.9984
AT1G15360 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integr... Potri.018G131400 5.29 0.9979
AT4G24340 Phosphorylase superfamily prot... Potri.013G081233 5.47 0.9981
AT4G24350 Phosphorylase superfamily prot... Potri.013G080400 5.65 0.9973
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.019G014398 10.48 0.9929
AT3G04290 ATLTL1, LTL1 Li-tolerant lipase 1 (.1) Potri.013G051000 10.48 0.9947

Potri.006G137800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.